Mouse Monoclonal COX IV Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal COX IV Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Goat, Hamster, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to NDUFAB1 (NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 93 and 156 of NDUFAB1 (Uniprot ID#O14561) |
Rabbit Polyclonal Anti-ATP6V0A2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
Rabbit Polyclonal SDHD Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SDHD antibody was raised against a 15 amino acid synthetic peptide near the center of human SDHD. |
Rabbit anti-NDUFS1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NDUFS1 |
Goat Polyclonal Anti-NDUFA7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-NDUFA7 Antibody: Peptide with sequence C-PKLPVGPSHKLSNN, from the internal region of the protein sequence according to NP_004992.2. |
Rabbit Polyclonal Anti-UCRC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit polyclonal anti-COX IV antibody, Loading control
Applications | IHC, WB |
Reactivities | Human, Mouse, Bovine, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit polyclonal ATP6V1B1 Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ATP6V1B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 284-310 amino acids from the Central region of human ATP6V1B1. |
Rabbit polyclonal anti-ATP5D antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP5D. |
Rabbit polyclonal anti-ATP5G3 antibody
Applications | IF, IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP5G3. |
Rabbit polyclonal anti-NDUFA8 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA8. |
COX7A2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | COX7A2 antibody was raised against synthetic peptide from human COX7S/A2 (aa1-50). |
Anti-COX6B2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-89 amino acids of human cytochrome c oxidase subunit VIb polypeptide 2 (testis) |
Anti-ATP5J rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-ATP5J rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit polyclonal COX41 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human COX41. |
Rabbit Polyclonal LYRM3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LYRM3 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human LYRM3. |
Rabbit Polyclonal antibody to COX6A2 (cytochrome c oxidase subunit VIa polypeptide 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 34 and 97 of COX6A2 (Uniprot ID#Q02221) |
Rabbit Polyclonal antibody to NDUFS8 (NADH dehydrogenase (ubiquinone) Fe-S protein 8, 23kDa (NADH-coenzyme Q reductase))
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 210 of NDUFS8 (Uniprot ID#O00217) |
Rabbit Polyclonal antibody to NDUFS2 (NADH dehydrogenase (ubiquinone) Fe-S protein 2, 49kDa (NADH-coenzyme Q reductase))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 200 and 430 of NDUFS2 (Uniprot ID#O75306) |
Rabbit polyclonal antibody to PPA1 (pyrophosphatase (inorganic) 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 289 of PPA1 (Uniprot ID#Q15181) |
Rabbit Polyclonal antibody to COX6B1 (cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 23 and 86 of COX6B1 (Uniprot ID#P14854) |
Rabbit Polyclonal antibody to NDUFB5 (NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 126 and 189 of NDUFB5 (Uniprot ID#O43674) |
Rabbit Polyclonal antibody to NDUFS1 (NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 432 and 664 of NDUFS1 (Uniprot ID#P28331) |
Rabbit Polyclonal antibody to NDUFA10 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 43 and 355 of NDUFA10 (Uniprot ID#O95299) |
Rabbit Polyclonal antibody to NDUFA10 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 115 and 355 of NDUFA10 (Uniprot ID#O95299) |
Rabbit Polyclonal antibody to NDUFS4 (NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 175 of NDUFS4 (Uniprot ID#O43181) |
Rabbit Polyclonal antibody to COX4 (cytochrome c oxidase subunit IV isoform 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 169 of COX4 (Uniprot ID#P13073) |
Rabbit Polyclonal antibody to COX7B2 (cytochrome c oxidase subunit VIIb2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 81 of COX7B2 (Uniprot ID#Q8TF08) |
Rabbit polyclonal anti-ATP5G2 antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP5G2. |
Rabbit polyclonal anti-NDUFA3 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA3. |
Rabbit polyclonal anti-NDUFB1 antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFB1. |
Rabbit polyclonal anti-NDUFS5 antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFS5. |
Rabbit polyclonal anti-COX17 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human COX17. |
Rabbit Polyclonal TYW4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4. |
Rabbit polyclonal ATP5J Antibody (Center)
Applications | IF, IHC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | This ATP5J antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 28-56 amino acids from the Central region of human ATP5J. |
Rabbit Polyclonal SDHB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an N-terminal region of the human SDHB protein (within residues 1-150). [Swiss-Prot P21912] |
Rabbit Polyclonal antibody to NDUFV2 (NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 249 of NDUFV2 (Uniprot ID#P19404) |
Rabbit Polyclonal antibody to COX5B (cytochrome c oxidase subunit Vb)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 129 of COX5B (Uniprot ID#P10606) |
Rabbit Polyclonal antibody to NDUFV1 (NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 218 and 459 of NDUFV1 (Uniprot ID#P49821) |
Rabbit Polyclonal antibody to NDUFA5 (NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 116 of NDUFA5 (Uniprot ID#Q16718) |
Rabbit Polyclonal antibody to ATP synthase delta (ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 168 of ATP synthase delta (Uniprot ID#P30049) |
Rabbit Polyclonal antibody to NDUFB9 (NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 9, 22kDa)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 162 of NDUFB9 |
Rabbit polyclonal anti-ATP6V1H antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ATP6V1H. |
Rabbit anti-SDHA Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SDHA |
Rabbit Polyclonal Anti-COX15 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COX15 antibody: synthetic peptide directed towards the N terminal of human COX15. Synthetic peptide located within the following region: DWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEY |
Rabbit polyclonal anti-COX5B antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COX5B. |
Rabbit polyclonal anti-NDUC2 antibody
Applications | IHC |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUC2. |
Rabbit polyclonal anti-NDUFS6 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFS6. |