BTK Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BTK |
BTK Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BTK |
Rabbit anti-IKBKG Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IKBKG |
TAP2 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TAP2 |
Phospho-ZAP70-Y493 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y493 of human ZAP70 |
Modifications | Phospho-specific |
Rabbit Monoclonal Antibody against CD8A (Clone EP1150Y)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to RAG2 (recombination activating gene 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 271 and 527 of RAG2 (Uniprot ID#P55895) |
Rabbit polyclonal anti-CD40 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CD40. |
Rabbit Monoclonal Antibody against BLNK (Clone Y491)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-CD3E Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CD3E |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human CD40L |
CD40 (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Rabbit Polyclonal BAFF Receptor Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BAFF Receptor antibody was raised against a synthetic peptide corresponding to amino acids near the carboxy terminus of human BAFF Receptor The peptide sequence is identical between human and mouse origin. |
Rabbit polyclonal BLNK (Tyr84) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BLNK around the phosphorylation site of tyrosine 84 (E-M-YP-V-M). |
Modifications | Phospho-specific |
Rabbit polyclonal LCK Antibody (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-52 amino acids from the N-terminal region of human LCK. |
Goat Polyclonal Antibody against AIRE (Internal Region)
Applications | IHC, WB |
Reactivities | Human, Pig |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KDVDLSQPRKGRKP, from the internal region of the protein sequence according to NP_000374.1. |
Rabbit Polyclonal UNG1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | UNG1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human UNG1. |
Rabbit Polyclonal UNG1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | UNG1 antibody was raised against a 13 amino acid peptide from near the amino terminus of human UNG1. |
Rabbit polyclonal IKK-gamma (Ser376) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 376 (Y-L-SP-S-P). |
Modifications | Phospho-specific |
Rabbit Polyclonal CIITA Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CIITA antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human CIITA. |
Rabbit polyclonal ZAP70 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ZAP70 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 276-304 amino acids from the Central region of human ZAP70. |
Rabbit polyclonal LCK Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 480-509 amino acids from the C-terminal region of human LCK. |
Rabbit Polyclonal Anti-TAP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
Goat Polyclonal Antibody against AIRE (C-terminal)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QSMARPAAPFPS, from the C Terminus of the protein sequence according to NP_000374.1, NP_000649.1. |
Rabbit polyclonal IKK-gamma (Ab-31) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IKK-? around the phosphorylation site of serine 31 (E-E-SP- P-L). |
Rabbit polyclonal IKK-gamma (Ser31) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 31 (E-E-SP-P-L). |
Modifications | Phospho-specific |
Rabbit polyclonal BTK (Ab-222) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human BTK around the phosphorylation site of tyrosine 222 (A-L-YP-D-Y). |
TAP2 Rabbit Polyclonal (aa689-703) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | TAP2 antibody was raised against synthetic peptide from human TAP2. |
Anti-ZAP70 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.317~321 (S-P-Y-S-D) derived from Human ZAP70. |
Rabbit anti-PTPRC Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human PTPRC |
CD8A rabbit monoclonal antibody, clone SP16, Supernatant
Applications | IHC |
Reactivities | Human |
Rabbit anti-ZAP70 (Phospho-Tyr493) polyclonal antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanZap-70 around the phosphorylation site of tyrosine 493 (S-Y-YP-T-A). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-IGLL1 antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IGLL1. |
Rabbit anti CD8 Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-ICOS Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 21-140 amino acids of human inducible T-cell co-stimulator |
Anti-ADA rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human adenosine deaminase |
Anti-ADA rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human adenosine deaminase |
Rabbit Polyclonal Anti-IKBKG Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IKBKG |
Rabbit Polyclonal Anti-IL2RG Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IL2RG |
Rabbit Polyclonal Anti-BLNK Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human BLNK |
Rabbit Polyclonal Anti-CD40 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CD40 |
Rabbit Polyclonal Anti-PTPRC Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PTPRC |
Rabbit Polyclonal Anti-TNFRSF13C Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TNFRSF13C |
Rabbit Polyclonal Anti-TAP2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TAP2 |
Rabbit Polyclonal Anti-TAP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TAP2 |
Rabbit Polyclonal Anti-AICDA Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human AICDA |