Germany
Japan
United Kingdom
China
Primary Antibodies
Download
CCR6 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | CCR6 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (94%); Monkey (89%); Opossum (83%). |
IL-17 Mouse Monoclonal (aa1-75) (4K5F6) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
USD 515.00
In Stock
Rabbit polyclonal TGFBR2 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit Polyclonal Anti-LEP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS |
Flt3 ligand (FLT3LG) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 180-230 of Human Flt3-L. |
IL5RA rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide, corresponding to amino acids 50-100 of Human IL-5Rα. |
Inhibin beta A (INHBA) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | This INHBA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 85-112 amino acids from the N-terminal region of human INHBA. |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal CCR5 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5. |
Rabbit polyclonal CSFR (Ab-809) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CSFR around the phosphorylation site of tyrosine 809 (S-N-YP-I-V). |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Rabbit anti-EPO Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EPO |
p75 NGF Receptor (NGFR) mouse monoclonal antibody, clone ME20.4, Biotin
| Applications | FC, IF, IHC, IP, NEUT, WB |
| Reactivities | Human |
| Conjugation | Biotin |
p75 NGF Receptor (NGFR) mouse monoclonal antibody, clone ME20.4, FITC
| Applications | FC, IF, IHC, IP, NEUT, WB |
| Reactivities | Human |
| Conjugation | FITC |
p75 NGF Receptor (NGFR) mouse monoclonal antibody, clone ME20.4, Purified
| Applications | FC, IF, IHC, IP, NEUT, WB |
| Reactivities | Human |
PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human PDGF-AA (Cat.-No PA118). |
Rabbit Polyclonal Antibody against CSF1R
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MCSF Receptor (CSF1R) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 940-971 amino acids from the C-terminal region of human MCSF Receptor (CSF1R). |
Active filters
Applications
- IHC
Pathways
- Cytokine-cytokine receptor interaction
Filter by
Target Symbol
- EGFR (59)
- KIT (58)
- TNFRSF8 (41)
- CD40 (40)
- CSF2 (24)
- HGF (23)
- MET (23)
- TNFRSF10B (22)
- CSF2RB (21)
- TNF (19)
- CSF1 (17)
- CSF3 (17)
- PDGFRA (17)
- PDGFRB (17)
- EGF (16)
- IL1A (16)
- KDR (16)
- KITLG (16)
- IL24 (15)
- IL2 (13)
- IL20 (13)
- PRL (13)
- CXCR4 (12)
- VEGFB (12)
- ACVR2A (11)
- IL6 (11)
- CCL19 (10)
- CSF1R (10)
- IFNLR1 (10)
- CXCL12 (9)
- IL12A (9)
- NGFR (9)
- TGFBR2 (9)
- TNFRSF18 (9)
- VEGFA (9)
- EPOR (8)
- IL12B (8)
- LEP (8)
- VEGFC (8)
- CD70 (7)
- IL23A (7)
- IL6R (7)
- OSM (7)
- PDGFB (7)
- TNFSF13 (7)
- VEGFD (7)
- CCL2 (6)
- CX3CR1 (6)
- FASLG (6)
- GH2 (6)
- IL10 (6)
- IL17A (6)
- IL17B (6)
- IL1B (6)
- PDGFA (6)
- TGFB1 (6)
- TNFRSF11B (6)
- TNFRSF1A (6)
- TNFRSF4 (6)
- CCR3 (5)
- CRLF2 (5)
- CXCR2 (5)
- CXCR3 (5)
- FLT1 (5)
- GH1 (5)
- IFNGR2 (5)
- IL10RA (5)
- IL3 (5)
- TSLP (5)
- ACVR1 (4)
- AMH (4)
- CCL20 (4)
- CCR1 (4)
- CCR5 (4)
- CCR6 (4)
- CCR7 (4)
- EDA (4)
- FLT3 (4)
- IFNB1 (4)
- IFNG (4)
- IL1R1 (4)
- IL23R (4)
- IL2RA (4)
- IL4 (4)
- INHBA (4)
- LEPR (4)
- TGFB3 (4)
- TNFRSF1B (4)
- TNFRSF6B (4)
- TNFSF11 (4)
- TNFSF14 (4)
- ACVR1B (3)
- BMP2 (3)
- BMP7 (3)
- CCL1 (3)
- CCL17 (3)
- CCL21 (3)
- CCL5 (3)
- CCR4 (3)
- CCR8 (3)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (1151)
- Transmembrane (791)
- Secreted Protein (621)
- ES Cell Differentiation/IPS (400)
- Protein Kinase (248)
- Adult stem cells (166)
- Stem cell - Pluripotency (99)
- Embryonic stem cells (82)
- Cancer stem cells (66)
- Stem cell relevant signaling - JAK/STAT signaling pathway (66)
- GPCR (64)
- Transcription Factors (33)
- Induced pluripotent stem cells (23)
- Protease (23)
- Stem cell relevant signaling - DSL/Notch pathway (7)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (7)