Germany
Japan
United Kingdom
China
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human, Monkey |
Primary Antibodies
View as table Download
Rabbit Polyclonal Antibody against CD8A (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A. |
Rabbit polyclonal IKK-gamma (Ser376) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 376 (Y-L-SP-S-P). |
| Modifications | Phospho-specific |
Goat polyclonal anti-Artemis antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 482-495 of Human ARTEMIS (DCLRE1C DNA cross-link repair 1C). |
Rabbit polyclonal ZAP70 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ZAP70 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 276-304 amino acids from the Central region of human ZAP70. |
Rabbit polyclonal LCK Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 480-509 amino acids from the C-terminal region of human LCK. |
Rabbit Polyclonal Anti-TAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
Mouse Monoclonal BTK Antibody (7F12H4)
| Applications | IHC, WB |
| Reactivities | Human, Primate |
| Conjugation | Unconjugated |
TA336560 is a replacement of AM06170SU-N.
CD8A mouse monoclonal antibody, clone RFT-8, APC-Cy7
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | APC-Cy7 |
CD8A mouse monoclonal antibody, clone RFT-8, Cy5
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | Cy5 |
CD8A mouse monoclonal antibody, clone RFT-8, Low Endotoxin
| Applications | FC, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone RFT-8, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy5.5
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | PE-Cy5.5 |
CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy7
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | PE-Cy7 |
CD8A mouse monoclonal antibody, clone CA-8, Aff - Purified
| Applications | IHC, IP |
| Reactivities | Human, Rat |
CD4 mouse monoclonal antibody, clone CA-4, Purified
| Applications | IF, IHC |
| Reactivities | Human |
CD19 mouse monoclonal antibody, clone AE1, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD3E mouse monoclonal antibody, clone CRIS-7, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human, Rhesus Monkey |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone B-C15, Azide Free
| Applications | FC, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone B-C15, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone B-Z31, Azide Free
| Applications | FC, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone B-Z31, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD4 mouse monoclonal antibody, clone EDU-2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone MCD8, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit polyclonal IKK-gamma (Ab-31) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IKK-? around the phosphorylation site of serine 31 (E-E-SP- P-L). |
Rabbit polyclonal IKK-gamma (Ser31) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 31 (E-E-SP-P-L). |
| Modifications | Phospho-specific |
TAP2 Rabbit Polyclonal (aa689-703) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | TAP2 antibody was raised against synthetic peptide from human TAP2. |
Mouse Monoclonal CD8 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal UNG Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | This antibody was generated by immunizing rabbit with a synthetic peptide sequence CRHFSKTNELLQKSGKKP corresponding to amino acids 281-298 of human UNG1 (NP 003353.1) and amino acids 290-307 of human UNG2 (NP 550433.1). The peptide sequence used for imm |
CD3E mouse monoclonal antibody, clone CA-3, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Rat |
CD8A mouse monoclonal antibody, clone 144B, Supernatant
| Applications | IHC |
| Reactivities | Human |
CD8A rabbit monoclonal antibody, clone SP16, Supernatant
| Applications | IHC |
| Reactivities | Human |
Rabbit anti-ZAP70 (Phospho-Tyr493) polyclonal antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanZap-70 around the phosphorylation site of tyrosine 493 (S-Y-YP-T-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-IGLL1 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IGLL1. |
Rabbit Polyclonal CD3 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal CD45R Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Applications
- IHC
Pathways
- Primary immunodeficiency