Germany
Japan
United Kingdom
China
CD61 (ITGB3) mouse monoclonal antibody, clone VIPL2, Aff - Purified
| Applications | FC, IHC, WB |
| Reactivities | Human, Primate |
Primary Antibodies
View as table Download
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VEGFR2 (Tyr1214) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-VEGFR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit polyclonal CAV2 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CAV2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 11-44 amino acids from the N-terminal region of human CAV2. |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R |
| Modifications | Phospho-specific |
Phospho-KDR-Y1175 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1175 of human KDR |
| Modifications | Phospho-specific |
Rabbit Polyclonal VEGF R2/KDR/Flk-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | Residues corresponding to the kinase insert or C-terminus of mouse VEGF Receptor 2 (residues 1158-1365). [Swiss-Prot# P35918] |
MET pTyr1234 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Antibody against Caveolin 1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DELSEKQVYDAH, from the internal region of the protein sequence according to NP_001744.2. |
ITGAV Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human ITGAV |
BCL2 (41-54) mouse monoclonal antibody, clone Bcl2/100, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
Integrin alpha 3 (ITGA3) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 500-550 of Human Integrin α3 |
Goat Polyclonal Antibody against BCL2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AGRTGYDNREIVMKYC, from the N Terminus of the protein sequence according to NP_000624; NP_000648. |
Rabbit polyclonal PDGFR beta (Ab-1021) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PDGFR β around the phosphorylation site of tyrosine 1021 (N-D-YP-I-I). |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF antibody: synthetic peptide directed towards the middle region of human EGF. Synthetic peptide located within the following region: ITIDFLTDKLYWCDAKQSVIEMANLDGSKRRRLTQNDVGHPFAVAVFEDY |
Rabbit Polyclonal Anti-Integrin a5 (CD49e) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Integrin a5 (CD49e) Antibody: A synthesized peptide derived from human Integrin a5 (CD49e) |
Rabbit Polyclonal Anti-Phospho-VEGFR2(Tyr1214) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-VEGFR2(Tyr1214) Antibody: A synthesized peptide derived from human VEGFR2 around the phosphorylation site of Tyrosine 1214 |
| Modifications | Phospho-specific |
Goat Polyclonal Anti-ERBB2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,177 aa to the C-terminus of human ERBB2 produced in E. coli. |
USD 530.00
2 Weeks
EGFR Non pTyr1197 (incl. pos. control) mouse monoclonal antibody, clone 20G3, Biotin
| Applications | ELISA, IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
USD 340.00
2 Weeks
Caveolin 1 (CAV1) (1-104) mouse monoclonal antibody, clone AT4C1, Purified
| Applications | ELISA, FC, IF, WB |
| Reactivities | Human, Rat |
USD 230.00
2 Weeks
Caveolin 1 (CAV1) (1-104) mouse monoclonal antibody, clone AT4C1, Purified
| Applications | ELISA, FC, IF, WB |
| Reactivities | Human, Rat |
Active filters
Applications
- WB
Families
- Transmembrane
Pathways
- Focal adhesion
Filter by
Category
Target Symbol
- EGFR (156)
- ERBB2 (153)
- BCL2 (86)
- MET (60)
- PDGFRA (57)
- KDR (42)
- PDGFRB (41)
- IGF1R (25)
- EGF (24)
- FLT4 (24)
- HGF (24)
- CAV1 (20)
- ITGB1 (17)
- ITGB3 (14)
- ITGA4 (8)
- CAV2 (7)
- ITGAV (7)
- ITGA5 (6)
- ITGA6 (6)
- ITGB5 (5)
- ITGB6 (5)
- CAV3 (4)
- ITGA3 (4)
- ITGA2 (3)
- ITGA2B (3)
- COL4A2 (2)
- ITGA1 (2)
- ITGA8 (2)
- ITGB7 (2)
- COL11A2 (1)
- ITGA11 (1)
- ITGA7 (1)
- ITGB8 (1)
- TNC (1)