Primary Antibodies

View as table Download

Rabbit polyclonal GLS Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This GLS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 516-545 amino acids from the C-terminal region of human GLS.

Rabbit polyclonal OAT Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This OAT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-55 amino acids from the N-terminal region of human OAT.

Rabbit Polyclonal iNOS Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human iNOS

Rabbit Polyclonal eNOS Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human eNOS.

Rabbit anti-ARG1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ARG1

Rabbit anti-ODC1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ODC1

Rabbit anti-PRODH Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRODH

Rabbit Polyclonal Anti-ASL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASL antibody: synthetic peptide directed towards the N terminal of human ASL. Synthetic peptide located within the following region: GATAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAE

Rabbit Polyclonal ALDH4A1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal eNOS Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal eNOS Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

CKMT1B mouse monoclonal antibody, clone AT17A2, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

Creatine kinase M type (CKM) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to the N-terminus of Human Creatine Kinase M.

ALDH2 (N-term) rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2.

ASS1 (196-212) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Bat, Bovine, Canine, Equine, Human, Monkey, Mouse, Porcine, Rat
Immunogen Synthetic peptide from an internal region of human ASS1

GLUD1 (+Glutamate dehydrogenase 2) goat polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_005262.1; NP_036216.2.

Rabbit Polyclonal Antibody against ALDH2 (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2.

Goat Polyclonal Antibody against Argininosuccinate synthetase 1

Applications WB
Reactivities Human, Cow
Conjugation Unconjugated
Immunogen Peptide with sequence C-ENPKNQAPPGLYTKTQD, from the internal region of the protein sequence according to NP_000041.2 ; NP_446464.1.

Goat Polyclonal Antibody against P4HA1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DFARKDEPDAFKE, from the internal region of the protein sequence according to NP_000908.2; NP_001017962.1.

Goat Anti-Arginase I Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence CFGLAREGNHKPID, from the C Terminus of the protein sequence according to NP_000036.2.

Rabbit Polyclonal antibody to ASL (argininosuccinate lyase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 86 and 325 of ASL

Rabbit polyclonal eNOS (Ser615) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of serine 615 (F-N-SP-I-S).
Modifications Phospho-specific

Anti-AMD1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 20-33 amino acids of human adenosylmethionine decarboxylase 1

Anti-NOS3 Rabbit Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.1175~1179 (T-Q-S-F-S) derived from Human eNOS.

Rabbit Polyclonal n-NOS (Ser852) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human n-NOS around the phosphorylation site of Serine 852
Modifications Phospho-specific

Rabbit anti-NOS1 Polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of human NOS1

Rabbit Polyclonal GLS2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Antibody was raised against a 18 amino acid peptide near the center terminus of human GLS2 (NP_037399).

Rabbit Polyclonal Anti-GLUD1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GLUD1 antibody: synthetic peptide directed towards the N terminal of human GLUD1. Synthetic peptide located within the following region: AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER

Rabbit Polyclonal Anti-ALDH7A1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH7A1 antibody: synthetic peptide directed towards the N terminal of human ALDH7A1. Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS

Rabbit Polyclonal Anti-LAP3 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Lap3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD

Rabbit Polyclonal Anti-CKM Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CKM antibody: synthetic peptide directed towards the N terminal of human CKM. Synthetic peptide located within the following region: VGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDL

Rabbit Polyclonal Anti-CKM Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CKM antibody: synthetic peptide directed towards the middle region of human CKM. Synthetic peptide located within the following region: GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI

Rabbit Polyclonal Anti-GAMT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAMT antibody: synthetic peptide directed towards the N terminal of human GAMT. Synthetic peptide located within the following region: MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM

Rabbit Polyclonal Anti-iNOS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-iNOS Antibody: A synthesized peptide derived from human iNOS

Rabbit Polyclonal Anti-nNOS Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-nNOS Antibody: A synthesized peptide derived from human nNOS

Rabbit Polyclonal Anti-iNOS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-iNOS Antibody: A synthesized peptide derived from human iNOS

Rabbit Polyclonal Anti-Phospho-eNOS(Ser615) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-eNOS(Ser615) Antibody: A synthesized peptide derived from human eNOS around the phosphorylation site of Sersine 615
Modifications Phospho-specific

Rabbit Polyclonal Anti-Phospho-n-NOS (Ser852) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-n-NOS (Ser852) Antibody: A synthesized peptide derived from human n-NOS around the phosphorylation site of Serine 852
Modifications Phospho-specific

NOS1 (1-181) mouse monoclonal antibody, clone N1, Purified

Applications IHC, WB
Reactivities Goat, Human, Porcine, Rat

CPS1 mouse monoclonal antibody, clone 8H8, Purified

Applications ELISA, IHC, WB
Reactivities Human

CKMT2 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

eNOS (NOS3) (1140-1190) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 1140-1190 of Human NOS3.

P4HA1 (431-443) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Bat, Canine, Chicken, Equine, Human, Monkey, Porcine, Rabbit
Immunogen Synthetic peptide from an internal region of human P4HA1

AMD1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of human SAMDC

Arginase 1 (ARG1) (1-145) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 145 of Human Arginase-1

eNOS (NOS3) (1181-1194) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Monkey, Rabbit
Immunogen kLH-conjugated, synthetic peptide corresponding to amino acids 1181-1194 of Human eNOS/NOS III

PYCR1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 290-319aa) of human PYCR1.

Rabbit Polyclonal Antibody against ALDH2 (N-term)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2.

Rabbit polyclonal antibody to Aminoacylase-1 (aminoacylase 1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 89 and 366 of Aminoacylase 1 (Uniprot ID#Q03154)

Rabbit Polyclonal antibody to Creatine kinase (brain) (creatine kinase, brain)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 165 and 381 of Creatine kinase (brain) (Uniprot ID#P12277)