Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CRY1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRY1 antibody: synthetic peptide directed towards the N terminal of human CRY1. Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF

Rabbit Polyclonal Anti-PER2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PER2 antibody: synthetic peptide directed towards the middle region of human PER2. Synthetic peptide located within the following region: VAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQ

NR1D1 mouse monoclonal antibody, clone 4F6

Applications ELISA, IF, IHC, RNAi, WB
Reactivities Human, Mouse

Rabbit Polyclonal Anti-CRY2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRY2 antibody: synthetic peptide directed towards the N terminal of human CRY2. Synthetic peptide located within the following region: IELNGQKPPLTYKRFQAIISRMELPKKPVGLVTSQQMESCRAEIQENHDE

Rabbit polyclonal anti-CKI-e antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-e.

Rabbit polyclonal anti-Clock antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Clock.

TPTEP2-CSNK1E rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 250-350 of Human Casein Kinase Iε.

Goat Polyclonal Antibody against Casein Kinase 1, delta

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DREERLRHSRNPATR, from the internal region of the protein sequence according to NP_001884.2; NP_620693.1.

Rabbit Polyclonal Anti-PER1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PER1 antibody is: synthetic peptide directed towards the N-terminal region of Human PER1. Synthetic peptide located within the following region: SGPLEGADGGGDPRPGESFCPGGVPSPGPPQHRPCPGPSLADDTDANSNG

Rabbit Polyclonal Anti-Clock Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Clock Antibody: A synthesized peptide derived from human Clock

Rabbit Polyclonal Anti-BHLHB3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHLHB3 Antibody: A synthesized peptide derived from human BHLHB3

SHARP1 (BHLHE41) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide around Lys31 of Human BHLHE41 / BHLHB3

Rabbit Polyclonal Antibody against MOP3

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Bacterially expressed human MOP3 (C-terminus).

Rabbit Polyclonal Anti-BHLHB2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BHLHB2 antibody: synthetic peptide directed towards the middle region of human BHLHB2. Synthetic peptide located within the following region: SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDE

CRY2 (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human CRY2.

PER3 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Cryptochrome I (CRY1) (551-555) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Mouse
Immunogen Peptide sequence around aa.551~555 (S-Q-G-S-G) derived from Human CRY1.

BMAL1 (ARNTL) (569-573) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around aa.569~573 derived from Human BMAL1

PER1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1155-1183 amino acids from the C-terminal region of human PER1

Rabbit Polyclonal Antibody against BMAL

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Bacterially expressed human BMAL1

Rabbit polyclonal antibody to SHARP2 (basic helix-loop-helix domain containing, class B, 2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 81 of SHARP2 (Uniprot ID#O14503)

Rabbit polyclonal NPAS2 Antibody (N-term)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This NPAS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human NPAS2.

Rabbit Polyclonal Anti-ARNTL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF

Rabbit Polyclonal Anti-CLOCK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLOCK antibody: synthetic peptide directed towards the N terminal of human CLOCK. Synthetic peptide located within the following region: LFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFN

Rabbit Polyclonal DEC2/SHARP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human PAI1/Serpine 1 protein (between residues 1-75) [UniProt Q9C0J9]

Cryptochrome I (CRY1) (551-555) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Mouse
Immunogen Peptide sequence around aa.551~555 (S-Q-G-S-G) derived from Human CRY1.

BMAL1 (ARNTL) (569-573) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around aa.569~573 derived from Human BMAL1

SHARP2 (BHLHE40) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 29-59 amino acids from the N-terminal region of human BHLHE40

Goat Polyclonal Antibody against CSNK1E

Applications WB
Reactivities Human
Immunogen Peptide with sequence C-PASQTSVPFDHLGK, from the C Terminus of the protein sequence according to NP_001885.1; NP_689407.1.

Goat Anti-BMAL1 / ARNTL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence REKITTNCYKFKIKD, from the internal region of the protein sequence according to NP_001169.3; NP_001025444.1.

Rabbit Polyclonal DEC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This DEC1 antibody maps to a region between residues 350 and the C-terminus (residue 412) of human Differentially Expressed in Chondrocytes NP_003661.1 (GeneID 8553).

Rabbit anti-CLOCK polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH

Rabbit polyclonal anti-CRY1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CRY1.

Rabbit polyclonal anti-PER3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PER3.

Rabbit Polyclonal Anti-PER1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PER1 antibody is: synthetic peptide directed towards the N-terminal region of Human PER1. Synthetic peptide located within the following region: LADDTDANSNGSSGNESNGHESRGASQRSSHSSSSGNGKDSALLETTESS

Rabbit Polyclonal Anti-BHLHB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-BHLHB3 Antibody: synthetic peptide directed towards the middle region of human BHLHB3. Synthetic peptide located within the following region: YCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTI

Rabbit Polyclonal Anti-NR1D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1D1 antibody: synthetic peptide directed towards the N terminal of human NR1D1. Synthetic peptide located within the following region: NGSFQSLTQGCPTYFPPSPTGSLTQDPARSFGSIPPSLSDDGSPSSSSSS

Rabbit Polyclonal Anti-PER3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PER3 Antibody: synthetic peptide directed towards the N terminal of human PER3. Synthetic peptide located within the following region: GAPQADVSMYSLEELATIASEHTSKNTDTFVAVFSFLSGRLVHISEQAAL

Rabbit Polyclonal Anti-NPAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NPAS2 Antibody: synthetic peptide directed towards the N terminal of human NPAS2. Synthetic peptide located within the following region: MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLE

Rabbit Polyclonal Anti-NPAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NPAS2 Antibody: synthetic peptide directed towards the C terminal of human NPAS2. Synthetic peptide located within the following region: DSLLLSTYSQQPGTLGYPQPPPAQPQPLRPPRRVSSLSESSGLQQPPR

Rabbit Polyclonal Anti-NR1D1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NR1D1 antibody: synthetic peptide directed towards the middle region of human NR1D1. Synthetic peptide located within the following region: SQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPA

Rabbit Polyclonal Anti-CSNK1D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSNK1D antibody: synthetic peptide directed towards the middle region of human CSNK1D. Synthetic peptide located within the following region: NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR

Rabbit Polyclonal Anti-CSNK1E Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-CSNK1E antibody: synthetic peptide directed towards the N terminal of human CSNK1E. Synthetic peptide located within the following region: MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH

Carrier-free (BSA/glycerol-free) ARNTL mouse monoclonal antibody, clone OTI1C11 (formerly 1C11)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARNTL mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARNTL mouse monoclonal antibody, clone OTI1D1 (formerly 1D1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARNTL mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CRY2 mouse monoclonal antibody, clone OTI1H5 (formerly 1H5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CSNK1E mouse monoclonal antibody, clone OTI2B3 (formerly 2B3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated