Primary Antibodies

View as table Download

Anti-Human IL-4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-4

Anti-Human IL-10 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-10

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN

Rabbit Polyclonal Anti-CD40 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD

Rabbit Polyclonal Anti-CD40 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV

Rabbit Polyclonal Anti-Granzyme B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Granzyme B Antibody: A synthesized peptide derived from human Granzyme B

Rabbit Polyclonal Anti-Interleukin 5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 5 Antibody: A synthesized peptide derived from human Interleukin 5

Rabbit Polyclonal Anti-FAS ligand Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FAS ligand Antibody: A synthesized peptide derived from human FAS ligand

Mouse Monoclonal Anti-CTLA-4 Antibody [1E6]

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-CTLA-4 Antibody [2G10]

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-CTLA-4 Antibody [8A1]

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-CD80 Antibody [11C12]

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-CD80 Antibody [12D9]

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Fas Ligand Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the C Terminus Region

Rabbit Polyclonal Fas Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

HLAG (HLA-G) mouse monoclonal antibody, clone G233, Aff - Purified

Applications ELISA, FC, IP
Reactivities Human

Thyroglobulin (TG) mouse monoclonal antibody, clone n.a, Purified

Applications ELISA, IHC
Reactivities Bovine, Human

Perforin (PRF1) mouse monoclonal antibody, clone B-D48, Azide Free

Applications FC, IHC, WB
Reactivities Human

CD28 mouse monoclonal antibody, clone B-T3, Azide Free

Applications FC, FN, IHC
Reactivities Human

IL2 mouse monoclonal antibody, clone B-G5, Azide Free

Applications FC, FN, WB
Reactivities Human

IL10 mouse monoclonal antibody, clone BN-10, FITC

Applications FC, IHC
Reactivities Human
Conjugation FITC

HLA-DOA rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human

HLADQA1 (HLA-DQA1) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 56-84 amino acids from the Central region of Human HLA class II DQ alpha 1 / HLA-DQA1

IL4 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIL-4 (human IL-4)

Rabbit polyclonal antibody to HLA-DMB (major histocompatibility complex, class II, DM beta)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 199 and 263 of HLA-DMB (Uniprot ID#P28068)

Rabbit Polyclonal antibody to interferon alpha 2 (interferon, alpha 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 125 and 188 of Interferon alpha 2 (Uniprot ID#P01563)

Rabbit polyclonal anti-IL4 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human IL4.

Rabbit polyclonal anti-HLA-DOA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HLA-DOA.

Rabbit polyclonal anti-HA2Q antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HA2Q.

Mouse Anti-Human CD95 (APO-1/Fas) Purified

Applications FC
Reactivities Human

Mouse Anti-Human HLA-DR Purified (100 ug)

Applications FC
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal IL4 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This L4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 122-150 amino acids from the C-terminal region of human L4.

Rabbit polyclonal CD28 Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD28 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-208 amino acids from the C-terminal region of human CD28.

Mouse monoclonal HLA-G Antibody(Ascites)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal HLA-B Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B.

Anti-Human IL-2 Goat Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-2

Anti-Human IL-2 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human IL-2

Rabbit polyclonal Anti-HLA-F Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT

Rabbit Polyclonal Anti-CD80 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CD80 antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human CD80. The immunogen is located within amino acids 60 - 110 of CD80.

Rabbit Polyclonal Anti-CD86 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CD86 antibody was raised against a peptide corresponding to 17 amino acids near the center of human CD86. The immunogen is located within amino acids 160 - 210 of CD86.

Mouse Monoclonal Anti-CD80 Antibody [8G12]

Applications FC, IF, IHC
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-CD80 Antibody [10A1]

Applications FC, IF, IHC
Reactivities Human
Conjugation Unconjugated

Mouse Monoclonal Anti-CD80 Antibody [11D1]

Applications FC, IF, IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Fas Ligand Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO28

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO34

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

TSH beta (TSHB) mouse monoclonal antibody, clone TSH-116, Aff - Purified

Applications ELISA, R
Reactivities Human

Thyroglobulin (TG) mouse monoclonal antibody, clone n.a, Purified

Applications ELISA, IHC
Reactivities Human

Fas Ligand (FASLG) mouse monoclonal antibody, clone B-R17, Purified

Applications FC
Reactivities Human

CD28 mouse monoclonal antibody, clone B-T3, Purified

Applications FC, IHC
Reactivities Human