Germany
Japan
United Kingdom
China
EGF mouse monoclonal antibody, clone KT2, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
Primary Antibodies
DownloadPDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) Recombinant Human PDGF-B. |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit anti-MTOR polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized non-phosphopeptide derived fromhuman mTOR around the phosphorylation site of serine 2448 (T-D-SP-Y-S). |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal SOS2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R |
| Modifications | Phospho-specific |
Cyclin D1 (CCND1) mouse monoclonal antibody, clone CD1.1
| Applications | ELISA, FC, IF, IHC, IP, WB |
| Reactivities | Human, Rat |
PDGF AA (PDGFA) (PDGF-AA) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) E.coli derived recombinant Human PDGF-AA (Cat.-No PA118). |
PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) Recombinant Human PDGF-B. |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit monoclonal antibody against Rb (clone EP44(2) )
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Rabbit polyclonal NRAS Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS. |
Anti-Human IGF-I Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IGF-I |
Rabbit anti-AKT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT1 |
Phospho-CDK6-Y13 Rabbit Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y13 of human CDK6 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SHC3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SHC3 antibody: synthetic peptide directed towards the middle region of human SHC3. Synthetic peptide located within the following region: RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST |
Rabbit Polyclonal Anti-RB1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RB1 |
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
EGF mouse monoclonal antibody, clone S-147, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
AKT1 (C-term) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
IGF1 mouse monoclonal antibody, clone M23/ILG1-001, Purified
| Applications | ELISA, R |
| Reactivities | Human |
Rabbit Polyclonal Antibody against MDM2 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2. |
Rabbit Polyclonal Antibody against FRAP1 (S2481)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This mTOR (FRAP1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 2459-2488 amino acids from human mTOR (FRAP1). |
Goat Anti-CAMK2A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PRTAQSEETRVWHR, from the internal region of the protein sequence according to NP_057065.2; NP_741960.1. |
Rabbit monoclonal antibody against PI3-kinase p110 subunit delta(clone EPR386)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Category
- Antibodies
Pathways
- Glioma
Filter by
Target Symbol
- TP53 (255)
- MAP2K1 (237)
- EGFR (207)
- CDKN2A (198)
- AKT1 (127)
- MDM2 (121)
- BRAF (100)
- MAPK1 (74)
- MTOR (72)
- PIK3CG (64)
- PDGFRA (63)
- RB1 (59)
- KRAS (58)
- PDGFRB (50)
- HRAS (47)
- PIK3R5 (47)
- AKT2 (44)
- EGF (38)
- CCND1 (37)
- CDKN1A (36)
- PIK3CD (35)
- MAP2K2 (34)
- RAF1 (33)
- SHC1 (32)
- IGF1 (31)
- CAMK2B (29)
- IGF1R (29)
- PRKCA (27)
- PIK3CA (25)
- ARAF (24)
- MAPK3 (23)
- PTEN (23)
- AKT3 (19)
- NRAS (17)
- PDGFB (16)
- PLCG1 (15)
- PIK3R1 (14)
- E2F1 (12)
- PRKCB (12)
- CAMK2A (11)
- GRB2 (11)
- PDGFA (11)
- CDK6 (10)
- CDK4 (9)
- E2F2 (9)
- PLCG2 (9)
- PRKCG (6)
- TGFA (6)
- CAMK2G (5)
- CALM2 (4)
- PIK3CB (4)
- PIK3R3 (4)
- CALM3 (3)
- CAMK2D (3)
- E2F3 (3)
- SHC3 (3)
- SOS2 (3)
- B RAF (2)
- PIK3R2 (2)
- SHC4 (2)
- SOS1 (2)
- CALM1 (1)
- CALML3 (1)
- CALML5 (1)
- CALML6 (1)
- SHC2 (1)
Reactivities
- Human (2259)
- Mouse (1594)
- Rat (1515)
- Monkey (411)
- Dog (334)
- Bovine (14)
- Chicken (13)
- Pig (10)
- Cow (7)
- Xenopus (7)
- Rabbit (6)
- Canine (5)
- Hamster (4)
- Drosophila (3)
- Canis (2)
- Chimpanzee (2)
- Primate (2)
- Rhesus Monkey (2)
- Feline (1)
- Fish (1)
- Guinea Pig (1)
- Horse (1)
- Porcine (1)
- Sheep (1)
- X. tropicalis (1)
- Yeast (1)
- Zebrafish (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (2499)
- Protein Kinase (1250)
- ES Cell Differentiation/IPS (693)
- Transcription Factors (459)
- Transmembrane (393)
- Stem cell - Pluripotency (292)
- Adult stem cells (245)
- Secreted Protein (244)
- Stem cell relevant signaling - JAK/STAT signaling pathway (244)
- Cancer stem cells (207)
- Embryonic stem cells (38)
- Induced pluripotent stem cells (38)
- Stem cell relevant signaling - DSL/Notch pathway (37)
- Stem cell relevant signaling - Wnt Signaling pathway (37)
- Phosphatase (23)