Primary Antibodies

View as table Download

EGFR L858R mouse monoclonal antibody,clone UMAB233

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EGFR L858R mouse monoclonal antibody,clone UMAB233

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody

Applications Dot, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2.
Modifications Phospho-specific

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

Rabbit Monoclonal Antibody against NOTCH1 (Clone EP1238Y)

Applications IF, IHC, WB
Reactivities Human, Mouse, Cow
Conjugation Unconjugated

Rabbit anti-ETS1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant Protein of human ETS1

Rabbit Polyclonal Anti-NOTCH2 (Cleaved-Ala1734) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-NOTCH2 (Cleaved-Ala1734) Antibody: A synthesized peptide derived from human NOTCH2 (Cleaved-Ala1734)

Rabbit Polyclonal Anti-GRB2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit anti-ETV6 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ETV6

NOTCH2 (2457-2471) rabbit polyclonal antibody, Purified

Applications ELISA, IHC
Reactivities Human, Monkey
Immunogen Synthetic peptide from human NOTCH2 (aa 2457-2471)

Rabbit Polyclonal Anti-MAP2K1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MAP2K1

Rabbit anti-MEK1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen C term -peptide of human MEK1

MAPK1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI6F8

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700062

Rabbit polyclonal Notch 1 (Cleaved-Val1744) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Notch 1.

Rabbit polyclonal SOS2 Antibody (N-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2.

Rabbit Polyclonal Anti-PIWIL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIWIL2 antibody: synthetic peptide directed towards the N terminal of human PIWIL2. Synthetic peptide located within the following region: QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM

KRAS mouse monoclonal antibody, clone AT2F8, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

ETS1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 46-74 amino acids from the N-terminal region of Human ETS1

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

Rabbit anti-GRB2 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human GRB2

Rabbit Polyclonal Anti-Notch 2 (Cleaved-Asp1733) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Notch 2 (Cleaved-Asp1733) Antibody: A synthesized peptide derived from human Notch 2 (Cleaved-Asp1733)

EGFR Non pTyr1197 (incl. pos. control) mouse monoclonal antibody, clone 20G3, Biotin

Applications ELISA, IF, IP, WB
Reactivities Human, Mouse
Conjugation Biotin

SOS1 mouse monoclonal antibody, clone SOS-1, Aff - Purified

Applications ELISA, IF, WB
Reactivities Human, Mouse

KRAS mouse monoclonal antibody, clone AT2F8, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

MEK1 (MAP2K1) (N-term) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Xenopus
Immunogen MAP2K1 antibody was raised against synthetic peptide derived from sequence near the amino-terminus of human MEK1, conjugated to KLH

EGFR sheep polyclonal antibody, Purified

Applications IF, IHC, IP, WB
Reactivities Chicken, Human, Mouse, Rat
Immunogen Synthetic 20 amino acid peptide of human EGFr representing a portion of the internal domain proximal to a phosphorylation region

Rabbit polyclonal Notch 2 (Cleaved-Asp1733) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Notch 2.

Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human: Thr693, Mouse: Thr695, Rat: Thr694
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S).
Modifications Phospho-specific

Rabbit polyclonal ETV6 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ETV6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 84-111 amino acids from the N-terminal region of human ETV6.

Rabbit Polyclonal ERK1/2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ERK1/2

Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204
Modifications Phospho-specific

Rabbit Polyclonal Anti-PIWIL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIWIL1 antibody: synthetic peptide directed towards the N terminal of human PIWIL1. Synthetic peptide located within the following region: FQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFR

Rabbit Polyclonal Anti-PIWIL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIWIL1 antibody: synthetic peptide directed towards the middle region of human PIWIL1. Synthetic peptide located within the following region: LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY

Rabbit Polyclonal Anti-EGFR Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-EGFR Antibody: A synthesized peptide derived from human EGFR

Rabbit Polyclonal Anti-MAPK1/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-MAPK1/3 Antibody: A synthesized peptide derived from human MAPK1/3

Rabbit Polyclonal Anti-SOS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOS2 Antibody: A synthesized peptide derived from human SOS2

Rabbit Polyclonal Anti-Notch 1 (Cleaved-Val1744) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Notch 1 (Cleaved-Val1744) Antibody: A synthesized peptide derived from human Notch 1 (Cleaved-Val1744)

Rabbit Polyclonal Anti-QSOX1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen QSOX1 antibody was raised against a 17 amino acid peptide near the center of human QSOX1.

Rabbit Polyclonal Anti-ETV7 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ETV7

purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI1B10

Applications LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700469

purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI2E1

Applications LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700471

purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI3D7

Applications LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700469

purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI3F2

Applications LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700472

purified EGFR Capture mouse monoclonal antibody, Luminex validated, clone OTI11H7

Applications LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700473

EGFR L858R mouse monoclonal antibody,clone UMAB233

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

USD 320.00

In Stock

Goat Polyclonal Anti-ERBB1 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli.

EGFR pTyr1069 (incl. pos. control) mouse monoclonal antibody, clone 11C2, Biotin

Applications ELISA, IP, WB
Reactivities Human, Mouse
Conjugation Biotin