Primary Antibodies

Download

Rabbit Polyclonal RPTOR Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A portion of amino acids 900-950 of human Raptor was used as the immunogen for this antibody.

Rabbit Polyclonal Anti-EIF4E2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4E2 antibody: synthetic peptide directed towards the N terminal of human EIF4E2. Synthetic peptide located within the following region: KDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQY

BRAF Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3C3

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700012

MAPK1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI6F8

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700062

Rabbit Polyclonal Antibody against BRAF (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF.

Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P).
Modifications Phospho-specific

Rabbit anti-MTOR polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized non-phosphopeptide derived fromhuman mTOR around the phosphorylation site of serine 2448 (T-D-SP-Y-S).

Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C).
Modifications Phospho-specific

Rabbit polyclonal SOS2 Antibody (N-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2.

Rabbit polyclonal FASN Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FASN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 942-973 amino acids from the Central region of human FASN.

Rabbit Polyclonal JNK1/2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human JNK1/2/3

Rabbit anti-EIF4E Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EIF4E

Rabbit Polyclonal Glut4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human Glucose Transporter GLUT4 protein (between residues 480-509) [UniProt P14672]

Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC

Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region

Applications WB
Reactivities Rat, Tobacco hornworm
Conjugation Unconjugated
Immunogen The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL

Mouse Monoclonal AKT(pan) Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal NRAS Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Monoclonal Antibody against FRAP1 (Clone Y391)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1.

Rabbit Polyclonal Antibody against AKT2 (N-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2.

Goat Polyclonal Antibody against Flotillin 1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SISQVNHKPLRTA, from the C Terminus of the protein sequence according to NP_005794.

Rabbit Polyclonal Akt1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Akt1 antibody was raised against a 16 amino acid peptide from near the amino-terminus of human Akt1.

Rabbit monoclonal antibody against IRS-2(clone EPR904(2))

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal antibody to PRKACA (protein kinase, cAMP-dependent, catalytic, alpha)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 351 of PKA C alpha (Uniprot ID#P17612)

Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873)

Rabbit polyclonal NRAS Antibody (N-term)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS.

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

PCK1 Rabbit Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human PCK1

Rabbit anti-PPP1CA Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP1CA

Rabbit anti-AKT1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human AKT1

Mouse Monoclonal GSK-3 beta Antibody (3D10)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated

Rabbit Polyclonal Anti-SHC3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SHC3 antibody: synthetic peptide directed towards the middle region of human SHC3. Synthetic peptide located within the following region: RLKPRPHAPDTAQFAGKEQTYYQGRHLGDTFGEDWQQTPLRQGSSDIYST

Rabbit Polyclonal AKT2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

BRAF Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4C11

Applications ELISA, LMNX
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Matched ELISA Pair TA700011

Rabbit Polyclonal Antibody against FRAP1 (S2481)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This mTOR (FRAP1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 2459-2488 amino acids from human mTOR (FRAP1).

Goat Polyclonal Antibody against SOCS1

Applications FC, WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-VLRDYLSSFPFQI, from the C Terminus of the protein sequence according to NP_003736.1.

Rabbit monoclonal antibody against Phospho IRS-1 (pY896)(EP260Y) (Phospho-Specific)

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Phospho-specific

Rabbit monoclonal antibody against PI3-kinase p110 subunit delta(Y387)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit monoclonal antibody against Raptor(EP539Y)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit monoclonal antibody against Phospho Tuberin (pS939)(EP1062Y) (Phospho-Specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Phospho-specific

Rabbit Polyclonal Rheb Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Rheb antibody was raised against a 15 amino acid peptide from the middle region of human Rheb.

Rabbit monoclonal antibody against PI3-kinase p110 subunit delta(clone EPR386)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal antibody to AMPK gamma 2 (protein kinase, AMP-activated, gamma 2 non-catalytic subunit)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 192 and 569 of AMPK gamma 2 (Uniprot ID#Q9UGJ0)

Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)

Applications IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646)

Rabbit Polyclonal SREBP1 Antibody

Applications WB
Reactivities Bovine, Hamster, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to a portion of the human SREBP1 protein sequence (between residues 700-800). [Uniprot# P36956]

Rabbit anti-BAD (Phospho-Ser136) polyclonal antibody (Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from mouse BAD around the phosphorylation site of serine136 (S-R-S[P]-A-P).
Modifications Phospho-specific

Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E).
Modifications Phospho-specific

Rabbit polyclonal IRS-1 (Ser307) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 307 (T-E-SP-I-T).
Modifications Phospho-specific