Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Rabbit polyclonal SYVN1 (HRD1) Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SYVN1 (HRD1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 586-617 amino acids from the C-terminal region of human SYVN1 (HRD1). |
Rabbit polyclonal FBXW11 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FBXW11 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-196 amino acids from the Central region of human FBXW11. |
Rabbit Polyclonal BRCA1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BRCA1 |
Rabbit Polyclonal BRCA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BRCA1 |
Rabbit Polyclonal CBL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CBL |
Rabbit Polyclonal CBL (Tyr674) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CBL around the phosphorylation site of Tyrosine 674 |
| Modifications | Phospho-specific |
Rabbit Polyclonal MDM2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MDM2 |
Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MDM2 around the phosphorylation site of Serine 166 |
| Modifications | Phospho-specific |
Rabbit Polyclonal XIAP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human XIAP |
Rabbit anti-VHL Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human VHL |
Rabbit Polyclonal Phospho-BRCA1 (Ser1423) Antibody (Phospho-specific)
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BRCA1 around the phosphorylation site of Serine 1423 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-BRCA1 (Ser1524) Antibody (Phospho-specific)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human BRCA1 around the phosphorylation site of Serine 1524 |
| Modifications | Phospho-specific |
Rabbit Polyclonal VHL Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human VHL |
Rabbit Polyclonal Anti-PRPF19 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the middle region of human PRPF19. Synthetic peptide located within the following region: PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK |
Rabbit Polyclonal Anti-HERC4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HERC4 antibody: synthetic peptide directed towards the middle region of human HERC4. Synthetic peptide located within the following region: LVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAIDHNEGFSL |
Rabbit Polyclonal Anti-UBE2N Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-UBE2N Antibody: synthetic peptide directed towards the middle region of human UBE2N. Synthetic peptide located within the following region: GRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNE |
Rabbit Polyclonal Anti-TRIM32 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the N terminal of human TRIM32. Synthetic peptide located within the following region: MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEK |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal EDD Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Cullin-7 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal BRCA1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal BRCA1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal BRCA1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Antibody against SAE1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SAE1 (AOS1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 300-329 amino acids from the C-terminal region of human SAE1 (AOS1). |
Rabbit Polyclonal Antibody against PIAS1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PIAS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 100-130 amino acids from the N-terminal region of human PIAS1. |
Rabbit Polyclonal Antibody against PIAS1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PIAS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 607-637 amino acids from the C-terminal region of human PIAS1. |
Rabbit Polyclonal Antibody against UBE2S (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This E2EPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 192-222 amino acids from the C-terminal region of human E2EPF. |
Rabbit Polyclonal Antibody against UBE2S (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This E2EPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human E2EPF. |
Goat Anti-PIAS2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KEAMKVSSQPCTKIE, from the internal region of the protein sequence according to NP_775298.1; NP_004662.2. |
Rabbit Polyclonal SOCS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SOCS1 antibody was raised against a 17 amino acid peptide from near the amino terminus of human SOCS1. |
Rabbit polyclonal antibody to CSA (excision repair cross-complementing rodent repair deficiency, complementation group 8)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 106 and 330 of CSA (Uniprot ID#Q13216) |
Rabbit Polyclonal antibody to CSA (excision repair cross-complementing rodent repair deficiency, complementation group 8)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 194 of CSA (Uniprot ID#Q13216) |
Rabbit Polyclonal antibody to UBE2B (ubiquitin-conjugating enzyme E2B (RAD6 homolog))
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 152 of UBE2B |
Rabbit Anti-Parkin (Ser101) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser101 conjugated to KLH |
| Modifications | Phospho-specific |
Rabbit Anti-Parkin (Ser378) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Ser378 conjugated to KLH |
| Modifications | Phospho-specific |
Goat Anti-UBR5 / EDD1 Antibody
| Applications | IHC |
| Reactivities | Human, Rat, Mouse, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-LAIKTKNFGFV, from the C Terminus of the protein sequence according to NP_056986.2. |
Active filters
Conjugates
- Unconjugated
Pathways
- Ubiquitin mediated proteolysis
Filter by
Target Symbol
- MDM2 (76)
- UBE2E3 (57)
- BRCA1 (38)
- SOCS3 (37)
- FBXW7 (32)
- UBE2G2 (31)
- UBE2J1 (28)
- BIRC3 (27)
- UBE2D2 (26)
- SAE1 (24)
- MGRN1 (22)
- ANAPC11 (21)
- ERCC8 (20)
- UBE2S (20)
- ANAPC2 (19)
- BTRC (19)
- KEAP1 (18)
- NEDD4 (18)
- UBOX5 (18)
- PIAS2 (16)
- AIRE (15)
- CUL4B (13)
- UBA3 (13)
- SMURF2 (11)
- SOCS1 (11)
- CBLC (10)
- TTK (10)
- PML (9)
- VHL (9)
- PIAS1 (8)
- PRKN (8)
- TRAF6 (8)
- UBE3B (8)
- ANAPC1 (7)
- CBL (7)
- CDC16 (7)
- CUL3 (7)
- DDB1 (7)
- STUB1 (7)
- UBE2K (7)
- UBE2L3 (7)
- CDC20 (6)
- CDC23 (6)
- CDC27 (6)
- CUL2 (6)
- SIAH1 (6)
- SYVN1 (6)
- TRIM32 (6)
- UBA2 (6)
- UBA7 (6)
- UBE2D1 (6)
- UBE2I (6)
- XIAP (6)
- ANAPC10 (5)
- BIRC2 (5)
- BIRC6 (5)
- CUL1 (5)
- CUL4A (5)
- CUL5 (5)
- DDB2 (5)
- ITCH (5)
- PIAS3 (5)
- UBE2B (5)
- UBE2C (5)
- ANAPC5 (4)
- CDC34 (4)
- CUL7 (4)
- ELOC (4)
- FANCL (4)
- FBXW11 (4)
- MAP3K1 (4)
- MID1 (4)
- PIAS4 (4)
- UBA1 (4)
- UBE2D4 (4)
- UBE2E1 (4)
- UBE2M (4)
- UBE2N (4)
- UBR5 (4)
- WWP2 (4)
- ANAPC13 (3)
- ANAPC4 (3)
- CDC26 (3)
- COP1 (3)
- FBXO4 (3)
- HERC4 (3)
- SKP1 (3)
- SKP2 (3)
- UBA6 (3)
- UBE2L6 (3)
- ANAPC7 (2)
- CIAP2 (2)
- ELOB (2)
- FBXO2 (2)
- FBXW8 (2)
- KLHL9 (2)
- NEDD4L (2)
- PPIL2 (2)
- PRPF19 (2)
- RCHY1 (2)