ERK1 (MAPK3) (+ERK2) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
ERK1 (MAPK3) (+ERK2) rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
MEK1 (MAP2K1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MEK1 (MAP2K1) pSer218 (+MAP2K2 pSer222) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
MEK1 (MAP2K1) pSer222 (+MAP2K2 pSer226) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
ERK1 (MAPK3) pThr202/pTyr204 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
BAX rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Complement C5 (C5) goat polyclonal antibody, Serum
Applications | ID, IP |
Reactivities | Human |
Immunogen | C5 protein is isolated as a homogenous protein for use in antiserum production. Freund’s complete adjuvant is used in the first step of the immunization |
Complement C5 (C5) rabbit polyclonal antibody, Biotin
Applications | ELISA |
Reactivities | Human |
Conjugation | Biotin |
IL6 goat polyclonal antibody, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Immunogen | Highly pure (> 98%) recombinant human IL-6 |
Rabbit Polyclonal Antibody against MAP2K1 (T291)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This MAP2K1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 270-299 amino acids from human MAP2K1. |
Rabbit Polyclonal Bax Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Bax antibody was raised against a peptide corresponding to 16 amino acids near the amino-terminus of human Bax. |
Rabbit polyclonal Bax (Ab-167) antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Bax around the phosphorylation site of threonine 167 (F-G-TP-P-T) |
Rabbit polyclonal anti-NOTCH 1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues of human Notch 1 located near the N-terminal sequence of the cleaved N intracellular domain (NICD). |
Rabbit polyclonal anti-EGR-1 antibody
Applications | IHC, WB |
Reactivities | Chimpanzee, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 94-108 (eqpyehltaesfpdi) of Human EGR-1. |
Anti-NCAM1 (CD56) Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.850~854(Q-T-K-E-N)derived from Human CD56(NCAM). |
Anti-ELK1 (Phospho-Ser389) Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 389 (P-R-S(p)-P-A) derived from Human Elk-1. |
Modifications | Phospho-specific |
Mouse monoclonal Erk1/2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Bax Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Bax. |
Rabbit Polyclonal Elk1 (Ser383) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Elk1 around the phosphorylation site of Serine 383 |
Modifications | Phospho-specific |
Rabbit Polyclonal anti-ERK2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide mapping to the carboxy terminus of rat ERK2 |
Anti-Human IL-1alpha Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-1alpha |
Anti-Human IL-6 Goat Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-6 |
Rabbit Polyclonal Anti-EGR1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EGR1 antibody: synthetic peptide directed towards the N terminal of human EGR1. Synthetic peptide located within the following region: DNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGGGGGGGGSNS |
Rabbit Polyclonal Anti-C8B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the middle region of human C8B. Synthetic peptide located within the following region: WKPGSSGPGSTGSWNSGSSGTGSTGNQNPGSPRPGSTGTWNPGSSERGSA |
Rabbit Polyclonal Anti-C8B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C8B antibody: synthetic peptide directed towards the C terminal of human C8B. Synthetic peptide located within the following region: SGSTTTTRRSCSKTVTKTVIGPDGHKEVTKEVVTSEDGSDCPEAMDLGTL |
Rabbit Polyclonal GRP78/HSPA5 Antibody
Applications | WB |
Reactivities | Mouse, Rat (Does not react with: Human, Primate) |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal portion of rat GRP78 (within residues 600-654). [UniProt# P06761] |
Rabbit Polyclonal GRP78/HSPA5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Chicken, Sheep |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of human GRP78 (within residues 250-300). [Swiss-Prot# P11021] |
Rabbit Polyclonal GRP78/HSPA5 Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminal portion of rat GRP78 (within residues 600-654). [Swiss-Prot# P06761] |
Rabbit Polyclonal Anti-PRKACB Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRKACB antibody: synthetic peptide directed towards the middle region of human PRKACB. Synthetic peptide located within the following region: NGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDI |
Rabbit Polyclonal Anti-SOD1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOD1 antibody: synthetic peptide directed towards the N terminal of human SOD1. Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE |
Rabbit Polyclonal Anti-Egr1 Antibody
Applications | IHC, WB |
Reactivities | Mouse, Xenopus |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Egr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTFASVPPAFPTQV |
Rabbit Polyclonal Anti-CCL5 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCL5 antibody: synthetic peptide directed towards the middle region of mouse CCL5. Synthetic peptide located within the following region: YGSDTTPCCFAYLSLELPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCAN |
Mouse Monoclonal Fyn Antibody
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
MAP2K1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3E6
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700334 |
MAP2K1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI5A11
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700334 |
MAP2K1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI7E2
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700334 |
MAP2K1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2B2
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700334 |
MAP2K1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1F9
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700335 |
MAP2K1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI6C6
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700335 |
MAP2K1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI7B1
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700335 |
MAP2K1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1A10
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700335 |
ELK1 pSer383 mouse monoclonal antibody, clone B4A12, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
ELK1 pSer383 mouse monoclonal antibody, clone D7H2, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
CD56 (NCAM1) mouse monoclonal antibody, clone B-A19, Azide Free
Applications | FC |
Reactivities | Human |
CD56 (NCAM1) mouse monoclonal antibody, clone B-A19, Purified
Applications | FC |
Reactivities | Human |
CD56 (NCAM1) mouse monoclonal antibody, clone B-A19, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
IL1 beta (IL1B) mouse monoclonal antibody, clone B-A15, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
IL6 mouse monoclonal antibody, clone B-E8, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
IL1 beta (IL1B) rabbit polyclonal antibody, Serum
Applications | WB |
Reactivities | Human |
Immunogen | Recombinant human Interleukin-1ß |
IL1 beta (IL1B) rabbit polyclonal antibody, Serum
Applications | WB |
Reactivities | Human |
Immunogen | Recombinant human Interleukin-1ß |