Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal Antibody against ATG5
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Mouse monoclonal H2AFX Antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-UCHL3 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the N terminal of human UCHL3. Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC |
Rabbit Polyclonal Anti-UCHL5 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL5 antibody: synthetic peptide directed towards the middle region of human UCHL5. Synthetic peptide located within the following region: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit polyclonal EN2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This EN2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-271 amino acids from the C-terminal region of human EN2. |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Mouse Monoclonal anti-DLG4 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against GNB2L1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GNB2L1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-58 amino acids from the N-terminal region of human GNB2L1. |
Rabbit Polyclonal Antibody against WIF1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This WIF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 51-80 amino acids from the N-terminal region of human WIF1. |
Goat Polyclonal Antibody against SMO (Internal region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QSDDEPKRIKKS, from the internal region of the protein sequence according to NP_005622.1. |
Mouse Monoclonal anti-slo1 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
UCP2 Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Xenopus, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | UCP2 antibody was raised against synthetic peptide C-DSVKQFYTKGSEH from an internal region of human UCP2 (NP_003346.2). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Dog, Horse, Rabbit, Pig, Opossum, Xenopus, Stickleback (100%); Smelt, Zebrafish (92%); Trout, Salmon (85%). |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Rabbit polyclonal METTL2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This METTL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 329-359 amino acids from the C-terminal region of human METTL2. |
Rabbit polyclonal Mib1/Mindbomb Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Mib1/Mindbomb antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human Mib1/Mindbomb. |
Rabbit Polyclonal Anti-PTBP1 Antibody
| Applications | WB |
| Reactivities | Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI |
Goat Polyclonal Anti-MNSOD (aa119-130) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Zebrafish, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MNSOD (aa119-130) Antibody: Peptide with sequence C-EAIKRDFGSFDK, from the internal region of the protein sequence according to NP_000627.2; NP_001019637.1. |
Goat Polyclonal Anti-CDH11 Antibody
| Applications | WB |
| Reactivities | Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide fused with GST and produced in E. coli. |
Goat Polyclonal Anti-CDH11 Antibody
| Applications | WB |
| Reactivities | Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 752 aa to the C-terminus of CDH11 produced in E. coli. |
Rabbit Polyclonal Antibody against FGFR1 (Y653)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FGFR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 631-660 amino acids from human FGFR1. |
Goat Polyclonal Antibody against TCF2 / VHNF1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QAYDRQKNPSKEER, from the internal region of the protein sequence according to NP_000449.1; NP_006472.1. |
Rabbit polyclonal antibody to VPS11 (vacuolar protein sorting 11 homolog (S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 300 and 392 of VPS11 (Uniprot ID#Q9H270) |
Rabbit polyclonal antibody to DMC1 (DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of DMC1 (Uniprot ID#Q14565) |
Rabbit polyclonal antibody to PSMC3 (proteasome (prosome, macropain) 26S subunit, ATPase, 3)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 51 and 361 of PSMC3 (Uniprot ID#P17980) |
Rabbit Polyclonal antibody to ARAF (v-raf murine sarcoma 3611 viral oncogene homolog)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 371 and 554 of A-RAF (Uniprot ID#P10398) |
Rabbit polyclonal antibody to PSMB8 (proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 52 and 276 of PSMB8 (Uniprot ID#P28062) |
Active filters
Reactivities
- Zebrafish
Families
- Druggable Genome
Filter by
Category
Target Symbol
- DNMT1 (3)
- KCNMA1 (3)
- CDH11 (2)
- H2AFZ (2)
- HPRT1 (2)
- KCNA2 (2)
- SMAD2 (2)
- SMAD3 (2)
- TUBA1A (2)
- ALAS2 (1)
- ARAF (1)
- ATG5 (1)
- AXIN1 (1)
- BAP1 (1)
- BCL11B (1)
- CALCRL (1)
- CCT8 (1)
- CDK5 (1)
- CKS2 (1)
- CSNK2B (1)
- CTNNB1 (1)
- DLG4 (1)
- DMC1 (1)
- DOCK1 (1)
- DUSP7 (1)
- DYRK2 (1)
- ECT2 (1)
- EIPR1 (1)
- EN2 (1)
- ESRRG (1)
- FGFR1 (1)
- FOSL2 (1)
- FOXC1 (1)
- GIPC1 (1)
- GLG1 (1)
- GNAT2 (1)
- GPR19 (1)
- GPR4 (1)
- GPRC5B (1)
- GSR (1)
- H2AFX (1)
- HNF1B (1)
- IPO7 (1)
- JMJD6 (1)
- KAT2B (1)
- MAPK14 (1)
- METTL2A (1)
- MIB1 (1)
- MYC (1)
- NPY (1)
- PCCB (1)
- PSMB8 (1)
- PSMC3 (1)
- PTBP1 (1)
- PTGES (1)
- RAB5A (1)
- RAB5B (1)
- RAB6A (1)
- RACK1 (1)
- SCN1A (1)
- SIAH1 (1)
- SLC25A25 (1)
- SMO (1)
- SOD2 (1)
- TBCK (1)
- TBP (1)
- TIMP2 (1)
- TMEM147 (1)
- TPM1 (1)
- TUBB (1)
- TYMS (1)
- UCHL3 (1)
- UCHL5 (1)
- UCP2 (1)
- VIPR2 (1)
- VPS11 (1)
- WIF1 (1)
- XPO7 (1)
- YWHAG (1)
- ZMPSTE24 (1)
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- Pathways in cancer (10)
- Wnt signaling pathway (10)
- Metabolic pathways (9)
- Colorectal cancer (8)
- Adherens junction (7)
- Cell cycle (6)
- Pancreatic cancer (5)
- TGF-beta signaling pathway (5)
- Vascular smooth muscle contraction (5)
- Chronic myeloid leukemia (4)
- Endometrial cancer (4)
- MAPK signaling pathway (4)
- Pathogenic Escherichia coli infection (4)
- Basal cell carcinoma (3)
- Cysteine and methionine metabolism (3)
- Gap junction (3)
- Huntington's disease (3)
- Prostate cancer (3)
- Regulation of actin cytoskeleton (3)
- Systemic lupus erythematosus (3)
- Acute myeloid leukemia (2)
- Amyotrophic lateral sclerosis (ALS) (2)
- Bladder cancer (2)
- Drug metabolism - other enzymes (2)
- Endocytosis (2)
- ErbB signaling pathway (2)
- Focal adhesion (2)
- Leukocyte transendothelial migration (2)
- Melanoma (2)
- Neuroactive ligand-receptor interaction (2)
- Neurotrophin signaling pathway (2)
- Progesterone-mediated oocyte maturation (2)
- Proteasome (2)
- Purine metabolism (2)
- RIG-I-like receptor signaling pathway (2)
- Thyroid cancer (2)
- Tight junction (2)
- Adipocytokine signaling pathway (1)
- Alzheimer's disease (1)
- Arachidonic acid metabolism (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Axon guidance (1)
- Basal transcription factors (1)
- Cardiac muscle contraction (1)
- Cell adhesion molecules (CAMs) (1)
- Dilated cardiomyopathy (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Fc epsilon RI signaling pathway (1)
- Glioma (1)
- Glutathione metabolism (1)
- Glycine (1)
- GnRH signaling pathway (1)
- Hedgehog signaling pathway (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Insulin signaling pathway (1)
- Jak-STAT signaling pathway (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Maturity onset diabetes of the young (1)
- Melanogenesis (1)
- NOD-like receptor signaling pathway (1)
- Natural killer cell mediated cytotoxicity (1)
- Non-small cell lung cancer (1)
- Notch signaling pathway (1)
- One carbon pool by folate (1)
- Oocyte meiosis (1)
- Porphyrin and chlorophyll metabolism (1)
- Propanoate metabolism (1)
- Pyrimidine metabolism (1)
- Regulation of autophagy (1)
- Renal cell carcinoma (1)
- Small cell lung cancer (1)
- T cell receptor signaling pathway (1)
- Toll-like receptor signaling pathway (1)
- Ubiquitin mediated proteolysis (1)
- VEGF signaling pathway (1)
- Valine (1)
- leucine and isoleucine degradation (1)
- p53 signaling pathway (1)
- serine and threonine metabolism (1)