Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal antibody to ATP6V1H (ATPase, H+ transporting, lysosomal 50/57kDa, V1 subunit H)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 169 and 444 of ATP6V1H (Uniprot ID#Q9UI12) |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal Antibody against ATG5
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit Polyclonal antibody to Citrate synthetase (citrate synthase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 110 and 412 of Citrate synthetase (Uniprot ID#O75390) |
Rabbit Polyclonal antibody to PDE6D (phosphodiesterase 6D, cGMP-specific, rod, delta)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of PDE6D (Uniprot ID#O43924) |
Mouse monoclonal H2AFX Antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-UCHL3 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the N terminal of human UCHL3. Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit Polyclonal antibody to VAPA (VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 29 and 122 of VAPA (Uniprot ID#Q9P0L0) |
Rabbit Polyclonal antibody to VCP (valosin-containing protein)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of VCP (Uniprot ID#P55072) |
Rabbit Polyclonal Anti-UCHL5 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL5 antibody: synthetic peptide directed towards the middle region of human UCHL5. Synthetic peptide located within the following region: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK |
Rabbit Polyclonal Antibody against SOX2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit polyclonal YOD1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This YOD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 319-347 amino acids from the C-terminal region of human YOD1. |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit polyclonal EN2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This EN2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-271 amino acids from the C-terminal region of human EN2. |
CALM1 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human calmodulin. |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Mouse Monoclonal anti-KCNA2B Antibody
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
Mouse Monoclonal anti-DLG4 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
Rabbit anti-STXBP1 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human STXBP1 |
Rabbit Polyclonal Antibody against TARDBP
| Applications | WB |
| Reactivities | Human, Primate, Mouse, Xenopus, Zebrafish, Chicken |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide to a C-terminal region [within residues 350-414] of the human TARDBP protein. [Swiss-Prot# Q13148] |
Rabbit Polyclonal Antibody against GNB2L1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GNB2L1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-58 amino acids from the N-terminal region of human GNB2L1. |
Rabbit Polyclonal Antibody against WIF1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This WIF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 51-80 amino acids from the N-terminal region of human WIF1. |
Goat Polyclonal Antibody against SMO (Internal region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QSDDEPKRIKKS, from the internal region of the protein sequence according to NP_005622.1. |
Goat Polyclonal Antibody against VANGL2
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QKYLRTTKQQPYH, from the internal region of the protein sequence according to NP_065068.1. |
Active filters
Reactivities
- Zebrafish
Filter by
Category
Target Symbol
- DNMT1 (3)
- GAPDH (3)
- KCNAB2 (3)
- KCNMA1 (3)
- ACTB (2)
- CDH11 (2)
- FAM50A (2)
- H2AFZ (2)
- HPRT1 (2)
- KCNA2 (2)
- MAT2A (2)
- RHO (2)
- SMAD2 (2)
- SMAD3 (2)
- TARDBP (2)
- TUBA1A (2)
- ACAD8 (1)
- AGR2 (1)
- AKT1 (1)
- ALAS2 (1)
- ARAF (1)
- ATG4B (1)
- ATG5 (1)
- ATP6V1H (1)
- AXIN1 (1)
- BAP1 (1)
- BCL11B (1)
- CALCRL (1)
- CASK (1)
- CCT8 (1)
- CDK5 (1)
- CKS2 (1)
- CLTC (1)
- CNOT7 (1)
- COMMD3-BMI1 (1)
- CRTC1 (1)
- CRYAA (1)
- CS (1)
- CSNK2B (1)
- CTNNB1 (1)
- DCT (1)
- DDX39A (1)
- DGAT1 (1)
- DLG4 (1)
- DLST (1)
- DMC1 (1)
- DMRTA2 (1)
- DOCK1 (1)
- DUSP7 (1)
- DYRK2 (1)
- ECT2 (1)
- EIF2B2 (1)
- EIPR1 (1)
- ELMO1 (1)
- EML1 (1)
- EN2 (1)
- ESRRG (1)
- FBXO43 (1)
- FGFR1 (1)
- FOSL2 (1)
- FOXC1 (1)
- FOXP2 (1)
- FPGT-TNNI3K (1)
- GALNT7 (1)
- GET3 (1)
- GIPC1 (1)
- GLG1 (1)
- GNAT2 (1)
- GPR19 (1)
- GPR4 (1)
- GPRC5B (1)
- GSR (1)
- H2AFX (1)
- H3C1 (1)
- HNF1B (1)
- HSP90B1 (1)
- HSPA1A (1)
- IDI1 (1)
- IPO7 (1)
- JMJD6 (1)
- KAT2B (1)
- LIAS (1)
- LIMCH1 (1)
- MAP1LC3A (1)
- MAPK14 (1)
- MCM7 (1)
- METTL2A (1)
- MGP (1)
- MIB1 (1)
- MLEC (1)
- MYC (1)
- NOLC1 (1)
- NPY (1)
- NSF (1)
- OPA1 (1)
- PCCB (1)
- PDE6D (1)
- PGD (1)
- PITX2 (1)
- PSMB8 (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
Assay Types
Families
- Druggable Genome (91)
- Transmembrane (32)
- Transcription Factors (27)
- ES Cell Differentiation/IPS (18)
- Embryonic stem cells (8)
- Cancer stem cells (6)
- Protease (6)
- Protein Kinase (6)
- GPCR (5)
- Ion Channels: Potassium (5)
- Secreted Protein (5)
- Stem cell - Pluripotency (5)
- Stem cell relevant signaling - JAK/STAT signaling pathway (5)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (5)
- Stem cell relevant signaling - Wnt Signaling pathway (3)
- Induced pluripotent stem cells (2)
- Adult stem cells (1)
- Nuclear Hormone Receptor (1)
- Phosphatase (1)
- Stem cell relevant signaling - DSL/Notch pathway (1)
Pathways
- Metabolic pathways (26)
- Wnt signaling pathway (12)
- Pathways in cancer (10)
- Adherens junction (9)
- Colorectal cancer (8)
- Cell cycle (7)
- Pathogenic Escherichia coli infection (6)
- TGF-beta signaling pathway (6)
- Cysteine and methionine metabolism (5)
- MAPK signaling pathway (5)
- Pancreatic cancer (5)
- Regulation of actin cytoskeleton (5)
- Tight junction (5)
- Vascular smooth muscle contraction (5)
- Vibrio cholerae infection (5)
- Alzheimer's disease (4)
- Chronic myeloid leukemia (4)
- Endocytosis (4)
- Endometrial cancer (4)
- Focal adhesion (4)
- Huntington's disease (4)
- Leukocyte transendothelial migration (4)
- Spliceosome (4)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- Basal cell carcinoma (3)
- Citrate cycle (TCA cycle) (3)
- Dilated cardiomyopathy (3)
- Gap junction (3)
- Glycolysis / Gluconeogenesis (3)
- Hypertrophic cardiomyopathy (HCM) (3)
- Progesterone-mediated oocyte maturation (3)
- Prostate cancer (3)
- Proteasome (3)
- Purine metabolism (3)
- Systemic lupus erythematosus (3)
- Acute myeloid leukemia (2)
- Amyotrophic lateral sclerosis (ALS) (2)
- Bladder cancer (2)
- Drug metabolism - other enzymes (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- ErbB signaling pathway (2)
- Glutathione metabolism (2)
- Lysosome (2)
- Melanoma (2)
- Neuroactive ligand-receptor interaction (2)
- Neurotrophin signaling pathway (2)
- O-Glycan biosynthesis (2)
- Oocyte meiosis (2)
- Propanoate metabolism (2)
- RIG-I-like receptor signaling pathway (2)
- Regulation of autophagy (2)
- Selenoamino acid metabolism (2)
- Thyroid cancer (2)
- Valine (2)
- Viral myocarditis (2)
- leucine and isoleucine degradation (2)
- Adipocytokine signaling pathway (1)
- Amino sugar and nucleotide sugar metabolism (1)
- Antigen processing and presentation (1)
- Arachidonic acid metabolism (1)
- Axon guidance (1)
- Basal transcription factors (1)
- Biosynthesis of unsaturated fatty acids (1)
- Cardiac muscle contraction (1)
- Cell adhesion molecules (CAMs) (1)
- Chemokine signaling pathway (1)
- DNA replication (1)
- Fc epsilon RI signaling pathway (1)
- Glioma (1)
- Glycerolipid metabolism (1)
- Glycine (1)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Glyoxylate and dicarboxylate metabolism (1)
- GnRH signaling pathway (1)
- Hedgehog signaling pathway (1)
- Insulin signaling pathway (1)
- Jak-STAT signaling pathway (1)
- Keratan sulfate biosynthesis (1)
- Limonene and pinene degradation (1)
- Lipoic acid metabolism (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Lysine degradation (1)
- Maturity onset diabetes of the young (1)
- Melanogenesis (1)
- NOD-like receptor signaling pathway (1)
- Natural killer cell mediated cytotoxicity (1)
- Non-small cell lung cancer (1)
- Notch signaling pathway (1)
- One carbon pool by folate (1)
- Oxidative phosphorylation (1)
- Pentose phosphate pathway (1)
- Porphyrin and chlorophyll metabolism (1)
- Prion diseases (1)
- Pyrimidine metabolism (1)
- RNA degradation (1)
- Renal cell carcinoma (1)
- Retinol metabolism (1)
- Ribosome (1)
- Small cell lung cancer (1)
- T cell receptor signaling pathway (1)
- Terpenoid backbone biosynthesis (1)
- Toll-like receptor signaling pathway (1)
- Ubiquitin mediated proteolysis (1)
- VEGF signaling pathway (1)
- p53 signaling pathway (1)
- serine and threonine metabolism (1)