USD 655.00
2 Weeks
Dopamine D2 Receptor (DRD2) (Short Isoform, 239-246) rabbit polyclonal antibody, Serum
Applications | ELISA, IF, IHC, WB |
Reactivities | Rat |
Immunogen | D2s (Ac239-Cys247) covalently attached to a carrier protein |
USD 655.00
2 Weeks
Dopamine D2 Receptor (DRD2) (Short Isoform, 239-246) rabbit polyclonal antibody, Serum
Applications | ELISA, IF, IHC, WB |
Reactivities | Rat |
Immunogen | D2s (Ac239-Cys247) covalently attached to a carrier protein |
Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Chimpanzee, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%). |
5 HT 2A (HTR2A) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%). |
5 HT 2A (HTR2A) rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Multiple antigenic peptide (MAP) of an N-terminal synthetic sequence corresponding to amino acids (22–41) of rat 5HT2A receptor. |
EDG2 (LPAR1) (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Rat |
Immunogen | Synthetic peptide - KLH conjugated |
Rabbit anti-DRD1 Polyclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human DRD1 |
Rabbit Polyclonal Anti-GRM5 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GRM5 Antibody: A synthesized peptide derived from internal of human GRM5. |
HTR2C rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 400-450 of Human SR-2C. |
Dopamine D2 Receptor (DRD2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 306-336 amino acids from the C-terminal region of Human Dopamine D2 receptor. |
USD 620.00
2 Weeks
Dopamine D2 Receptor (DRD2) (long isoform, 243-254) rabbit polyclonal antibody, Serum
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Rat |
Immunogen | D2L (243-254) cyclized covalently attached to a carrier protein. |
USD 531.00
In Stock
Rabbit Monoclonal Antibody against GRM5 (Clone EPR2425Y)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-EDG2 / LPAR1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human EDG2. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-5-HT-2C antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human 5-HT-2C. |
Rabbit Polyclonal Anti-ADRB1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV |
HTR2C rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-ADRB1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADRB1 . |
HTR2C rabbit polyclonal antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
HTR2C rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide containing a sequence corresponding to a region within amino acids 387 and 446 of Human 5HT2C Receptor. |
Goat Polyclonal Antibody against ADRB1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide with sequence ESDEARRCYNDPK, from the internal region of the protein sequence according to NP_000675.1. |
Rabbit anti-LPAR1 polyclonal antibody
Applications | WB |
Reactivities | Human, Bovine, Murine, Rat, Ovine |
Conjugation | Unconjugated |
Immunogen | Human LPA 1 amino acids 342-359 |
Rabbit Polyclonal metabotropic Glutamate Receptor 1a Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide comprising internal residues of the human GluR1 alpha protein. Reacts with rat and mouse GluR1. |
Rabbit Polyclonal metabotropic Glutamate Receptor 1a Antibody
Applications | IHC, WB |
Reactivities | Chicken, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide comprising residues 1159-1171 [SSVPSSPVSESVL] of the human GluR1 protein. |
Rabbit Polyclonal Anti-GRM5 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GRM5 / MGLUR5 antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human GRM5 / MGLUR5. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Hamster, Horse, Rabbit, Pig, Turkey, Zebra finch, Chicken, Platypus, Lizard (100%); Xenopus (94%); Opossum, Pufferfish (88%); Zebrafish (82%). |
Rabbit Polyclonal Anti-ADRB1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADRB1 antibody: synthetic peptide directed towards the middle region of human ADRB1. Synthetic peptide located within the following region: CTVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASS |
Dopamine Receptor D1 (DRD1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human DRD1 |
Goat Polyclonal Antibody against HTR2C
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QVENLELPVN, from the internal region of the protein sequence according to NP_000859.1. |
Rabbit polyclonal anti-DRD1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internalof human DRD1. |
Modifications | Phospho-specific |
Rabbit polyclonal anti-GRM1 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GRM1. |
Dopamine D2 Receptor (Cytoplasmic Domain) rabbit polyclonal antibody, Immunoaffinity purified
Applications | IHC |
Reactivities | Bat, Bovine, Chimpanzee, Dog, Gorilla, Human, Rabbit, Horse (Predicted: Monkey, Pig) |
Conjugation | Unconjugated |
Immunogen | Synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Ferret, Bat, Bovine, Dog, Elephant, Panda, Horse, Rabbit (100%); Gibbon, Monkey, Pig (94%); Marmoset (81%). |
Rabbit Polyclonal Anti-HTR2A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HTR2A antibody: synthetic peptide directed towards the N terminal of human HTR2A. Synthetic peptide located within the following region: DILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSEN |
Rabbit Polyclonal Anti-HTR2C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HTR2C antibody: synthetic peptide directed towards the N terminal of human HTR2C. Synthetic peptide located within the following region: SPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMA |
Rabbit Polyclonal Anti-GRM1 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GRM1 / MGLUR1 antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human GRM1 / MGLUR1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Elephant, Panda, Bovine, Rabbit (100%); Monkey, Marmoset, Mouse, Rat, Hamster, Dog, Bat, Horse, Opossum (94%); Chicken, Platypus (88%); Xenopus (82%). |
Rabbit Polyclonal Anti-GRM1 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | GRM1 / MGLUR1 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GRM1 / MGLUR1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Rabbit, Horse (94%); Opossum, Chicken, Platypus (88%); Bovine, Xenopus (81%). |
Rabbit Polyclonal Anti-GRM5 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | GRM5 / MGLUR5 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human GRM5 / MGLUR5. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bat, Bovine, Horse (100%); Platypus (95%); Opossum, Turkey, Chicken, Lizard (90%). |
Rabbit anti mGluR5 Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Rabbit, Rat |
Immunogen | A synthetic peptide derived from C-terminus of human Glutamate receptor. This sequence is identical to human and rat. |
Rabbit anti mGluR1 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) LPAR1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-ADRB1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Beta-1 adrenergic receptor |
Anti-DRD1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 10-23 amino acids of Human Dopamine receptor D1 |
Anti-DRD1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 10-23 amino acids of Human Dopamine receptor D1 |
Anti-GRM1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 31-44 amino acids of Human glutamate receptor, metabotropic 1 |
Anti-GRM1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 31-44 amino acids of Human glutamate receptor, metabotropic 1 |
Rabbit Polyclonal Anti-LPAR1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human LPAR1 |
Rabbit Polyclonal Anti-HTR2C Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human HTR2C |
DRD1 Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
LPAR1 (EDG2) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
LPAR1 (EDG2) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
LPAR1 (EDG2) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
LPAR1 (EDG2) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |