Germany
Japan
United Kingdom
China
KCNQ3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 650-679 amino acids from the C-terminal region of human KCNQ3 |
Primary Antibodies
View as table Download
KCNQ5 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 780-809 amino acids from the C-terminal region of human KCNQ5 |
Rabbit Polyclonal Antibody against TREK 1
| Applications | WB |
| Reactivities | Human, Mouse, Bovine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide within the N-terminal region [residues 1-100] of the human TREK 1 protein. [Swiss-Prot# Q9NRT2] |
Goat Polyclonal Antibody against KCNC3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KPGPPSFLPDLNAN, from the C Terminus of the protein sequence according to NP_004968.2. |
Goat Polyclonal Antibody against KCNJ11
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-AEDPAKPRYRARQ, from the internal region (near the N Terminus) of the protein sequence according to NP_000516.3. |
Goat Polyclonal Antibody against KCNJ6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SSKLNQHAELET, from the C Terminus of the protein sequence according to NP_002231.1. |
Goat Anti-KCNJ1 / ROMK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DQININFVVDAGNEN , from the internal region of the protein sequence according to NP_000211.1; NP_722448.1. |
Goat Anti-KCNQ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EQLTVPRRGPDEGS, from the C-Terminus of the protein sequence according to NP_000209.2; NP_861463.1. |
Goat Anti-KCNQ4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKGPSDAEVVDE, from the internal region of the protein sequence according to NP_004691.2; NP_751895.1. |
Rabbit polyclonal antibody to KCNQ5 (potassium voltage-gated channel, KQT-like subfamily, member 5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 458 and 714 of KCNQ5 (Uniprot ID#Q9NR82) |
Rabbit Polyclonal Kv1.2 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a portion of rat Kv1.2 (within residues 325-375). [Swiss-Prot# P63142] |
Rabbit Polyclonal Kv1.2 Antibody
| Applications | IF |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a portion of rat Kv1.2 (within residues 50-100). [Swiss-Prot# P63142] |
Rabbit polyclonal anti-KCNQ4 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human KCNQ4. |
Rabbit polyclonal anti-KCNJ15 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human KCNJ15. |
Rabbit polyclonal Kv7.3/KCNQ3 (Thr246) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human: Thr246, Mouse: Thr247, Rat: Thr247 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Kv7.3/KCNQ3 around the phosphorylation site of threonine 246 (G-G-TP-W-K). |
| Modifications | Phospho-specific |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bovine, Chicken, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Horse, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
KCNN2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Immunogen | KCNN2 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human KCNN2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Hamster, Panda, Dog, Horse, Guinea pig (94%); Marmoset, Rat, Elephant, Bat (89%); Mouse, Pig (83%). |
KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Guinea pig, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | KCNJ6 / GIRK2 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Panda, Bat (94%); Opossum (89%). |
KCNH2 / HERG Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Gorilla, Human, Monkey, Mouse, Rat |
| Immunogen | KCNH2 / HERG antibody was raised against synthetic 17 amino acid peptide from internal region of human KCNH2 / Kv11.1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Panda, Bat (100%); Elephant, Dog, Horse, Rabbit, Guinea pig (94%); Hamster (82%). |
KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Bovine, Hamster, Human, Monkey, Mouse, Orang-Utan, Rat, Gorilla, Dog, Pig, Horse, Gibbon |
| Conjugation | Unconjugated |
| Immunogen | KCNJ6 / GIRK2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig (100%); Opossum (93%); Turkey, Platypus, Lizard (87%). |
Mouse Monoclonal Anti-Kv1.2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-Kv1.6 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-K2P3.1 (TASK-1)
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)EDEKRDAEHRALLTRNGQ, corresponding to amino acid residues 252-269 of human K2P3.1 (TASK-1). Intracellular, C-terminal part. |
Rabbit Polyclonal Anti-KCa2.3 (C-term)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)KQIGSLESKLEHLTAS, corresponding to amino acid residues 659-674 of human KCa2.3. Intracellular, C-terminal part. |
Rabbit Polyclonal Anti-K2P6.1
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)ESHQQLSASSHTDYASIPR, corresponding to residues 295-313 of human K2P6.1 (TWIK-2).Intracellular, C-terminus. |
Rabbit Polyclonal Anti-KV4.3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)NEALELTGTPEEEHMGK, corresponding to amino acid residues 451-468 of human Kv4.3. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-KV1.8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)KDPETLLPTNDIHCR, corresponding to amino acid residues 187- 200 of human KV1.8. Intracellular, N-terminus. |
Rabbit Polyclonal Anti-KV7.1 (KCNQ1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)TYEQLTVPRRGPDEGS, corresponding to amino acid residues 661-676 of human Kv7.1. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-KV1.3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human Kv1.3. Intracellular, C-terminus. |
Rabbit polyclonal Anti-KCNMA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNMA1 antibody: synthetic peptide directed towards the middle region of human KCNMA1. Synthetic peptide located within the following region: ESRSRKRILINPGNHLKIQEGTLGFFIASDAKEVKRAFFYCKACHDDITD |
Rabbit polyclonal Anti-KCNK5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNK5 antibody: synthetic peptide directed towards the C terminal of human KCNK5. Synthetic peptide located within the following region: TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSES |
Rabbit polyclonal Anti-KCNH3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNH3 antibody: synthetic peptide directed towards the middle region of human KCNH3. Synthetic peptide located within the following region: LYPEFAPRFSRGLRGELSYNLGAGGGSAEVDTSSLSGDNTLMSTLEEKET |
Rabbit polyclonal Anti-KCNV1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNV1 antibody: synthetic peptide directed towards the N terminal of human KCNV1. Synthetic peptide located within the following region: ALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAVVVASYRRPGALAAVP |
Rabbit polyclonal Anti-KCNQ5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ5 antibody: synthetic peptide directed towards the middle region of human KCNQ5. Synthetic peptide located within the following region: LGKGQITSDKKSREKITAEHETTDDLSMLGRVVKVEKQVQSIESKLDCLL |
Rabbit Polyclonal Anti-KCNB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNB1 antibody: synthetic peptide directed towards the middle region of human KCNB1. Synthetic peptide located within the following region: YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEKNHFESSPLPT |
Rabbit Polyclonal Anti-KCNA5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNA5 antibody: synthetic peptide directed towards the N terminal of human KCNA5. Synthetic peptide located within the following region: DPGVRPLPPLPEELPRPRRPPPEDEEEEGDPGLGTVEDQALGTASLHHQR |
Rabbit Polyclonal Kv1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopu |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to rat Kv1.2 (within residues 50-100), which is identical in all members of the Kv1 family. |
Rabbit Polyclonal Potassium Channel Kv3.1 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of rat Kv3.1 (within residues 350-400). [Swiss-Prot# P25122] |
Rabbit Polyclonal Anti-KCNJ5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNJ5 antibody: synthetic peptide directed towards the N terminal of human KCNJ5. Synthetic peptide located within the following region: AGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQ |
Rabbit Polyclonal Anti-KCNG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNG1 antibody: synthetic peptide directed towards the N terminal of human KCNG1. Synthetic peptide located within the following region: MTLLPGDNSDYDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQD |
Rabbit Polyclonal Anti-KCNK3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNK3 antibody: synthetic peptide directed towards the C terminal of human KCNK3. Synthetic peptide located within the following region: TCVEQSHSSPGGGGRYSDTPSRRCLCSGAPRSAISSVSTGLHSLSTFRGL |
Rabbit Polyclonal Anti-KCNN1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNN1 antibody: synthetic peptide directed towards the C terminal of human KCNN1. Synthetic peptide located within the following region: KIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEARLATLESRLD |
Rabbit Polyclonal Anti-KCNS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNS1 antibody: synthetic peptide directed towards the N terminal of human KCNS1. Synthetic peptide located within the following region: LMLLVRGTHYENLRSKVVLPTPLGGRSTETFVSEFPGPDTGIRWRRSDEA |
Rabbit Polyclonal Anti-Kcnk5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Kcnk5 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AWLSLFVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQMAGSTAS |
Rabbit Polyclonal Anti-Kcnq3 Antibody
| Applications | WB |
| Reactivities | Hamster, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Kcnq3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMGKFVKVERQ |
Rabbit Polyclonal Anti-KCNQ4 Antibody
| Applications | WB |
| Reactivities | Hamster, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNQ4 antibody: synthetic peptide directed towards the middle region of human KCNQ4. Synthetic peptide located within the following region: SSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQ |
Rabbit Polyclonal Anti-KCNC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNC3 antibody: synthetic peptide directed towards the middle region of human KCNC3. Synthetic peptide located within the following region: YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGM |
Rabbit Polyclonal Anti-KCND3 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCND3 antibody: synthetic peptide directed towards the middle region of human KCND3. Synthetic peptide located within the following region: KARLARIRVAKTGSSNAYLHSKRNGLLNEALELTGTPEEEHMGKTTSLIE |
Rabbit Polyclonal Anti-KCNJ4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNJ4 antibody: synthetic peptide directed towards the middle region of human KCNJ4. Synthetic peptide located within the following region: AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI |
Active filters
Families
- Ion Channels: Potassium
Filter by
Category
Target Symbol
- KCNJ3 (43)
- KCNH2 (8)
- KCNK1 (8)
- KCNQ1 (8)
- KCNA3 (7)
- KCNMA1 (7)
- KCNN4 (7)
- KCNA1 (5)
- KCNA2 (5)
- KCNC1 (5)
- KCNC2 (5)
- KCND1 (5)
- KCNH3 (5)
- KCNJ11 (5)
- KCNQ2 (5)
- KCNQ4 (5)
- KCNQ5 (5)
- KCNA5 (4)
- KCNB1 (4)
- KCNG1 (4)
- KCNJ4 (4)
- KCNJ6 (4)
- KCNK10 (4)
- KCNK13 (4)
- KCNN2 (4)
- KCNA10 (3)
- KCNC3 (3)
- KCNC4 (3)
- KCND3 (3)
- KCNG4 (3)
- KCNH8 (3)
- KCNJ16 (3)
- KCNK12 (3)
- KCNK2 (3)
- KCNK3 (3)
- KCNK4 (3)
- KCNK5 (3)
- KCNN3 (3)
- KCNQ3 (3)
- KCNV2 (3)
- KCNA6 (2)
- KCNA7 (2)
- KCND2 (2)
- KCNJ1 (2)
- KCNJ12 (2)
- KCNJ15 (2)
- KCNJ2 (2)
- KCNJ8 (2)
- KCNJ9 (2)
- KCNK15 (2)
- KCNK17 (2)
- KCNK18 (2)
- KCNK6 (2)
- KCNK9 (2)
- KCNS1 (2)
- KCNG2 (1)
- KCNH1 (1)
- KCNH4 (1)
- KCNH5 (1)
- KCNJ13 (1)
- KCNJ5 (1)
- KCNN1 (1)
- KCNS2 (1)
- KCNT1 (1)
- KCNT2 (1)
- KCNV1 (1)