Rabbit polyclonal GR (Ser226) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human GR around the phosphorylation site of serine 226 (L-L-SP-P-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-NR1I3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NR1I3. |
Rabbit polyclonal RARA Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This RARA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-349 amino acids from the C-terminal region of human RARA. |
Rabbit polyclonal ESRRA Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ESRRA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 131-159 amino acids from the Central region of human ESRRA. |
Rabbit polyclonal NR1H3 Antibody (Center)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NR1H3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 226-253 amino acids from the Central region of human NR1H3. |
Rabbit Polyclonal AhR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AhR |
Rabbit anti-THRB Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human THRB |
Rabbit anti-HNF4A Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HNF4A |
Rabbit anti-NR1H3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NR1H3 |
Rabbit anti-ESR2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ESR2 |
Rabbit anti-PGRMC1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGRMC1 |
Rabbit Polyclonal Anti-NR1H4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1H4 antibody: synthetic peptide directed towards the middle region of human NR1H4. Synthetic peptide located within the following region: AECLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTTKSCREKT |
Rabbit Polyclonal Anti-NR1H4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1H4 antibody: synthetic peptide directed towards the middle region of human NR1H4. Synthetic peptide located within the following region: SAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSI |
Rabbit Polyclonal Anti-RXRG Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRG antibody: synthetic peptide directed towards the C terminal of human RXRG. Synthetic peptide located within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT |
Rabbit Polyclonal Anti-NR2E3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2E3 antibody: synthetic peptide directed towards the N terminal of human NR2E3. Synthetic peptide located within the following region: METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVC |
Rabbit Polyclonal Anti-NR2E3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NR2E3 antibody is: synthetic peptide directed towards the C-terminal region of Human NR2E3. Synthetic peptide located within the following region: EHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELL |
Rabbit Polyclonal Anti-PPARG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARG antibody: synthetic peptide directed towards the N terminal of human PPARG. Synthetic peptide located within the following region: MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDL |
Rabbit Polyclonal Anti-NR2F2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2F2 antibody: synthetic peptide directed towards the C terminal of human NR2F2. Synthetic peptide located within the following region: EYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF |
Rabbit Polyclonal Anti-RXRB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRB antibody: synthetic peptide directed towards the C terminal of human RXRB. Synthetic peptide located within the following region: AKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIG |
Rabbit Polyclonal Anti-NR1I2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NR1I2 antibody is: synthetic peptide directed towards the N-terminal region of Human NR1I2. Synthetic peptide located within the following region: AELASNHPRGPEANLEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVG |
Rabbit Polyclonal Anti-ZNF335 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF335 antibody: synthetic peptide directed towards the middle region of human ZNF335. Synthetic peptide located within the following region: EAAAHSAVTAVADAAMAQAQGLFGTDETVPEHIQQLQHQGIEYDVITLAD |
Rabbit Polyclonal Anti-NR1I2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1I2 antibody: synthetic peptide directed towards the N terminal of human NR1I2. Synthetic peptide located within the following region: MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATG |
Rabbit Polyclonal Anti-NR2F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2F1 antibody: synthetic peptide directed towards the C terminal of human NR2F1. Synthetic peptide located within the following region: VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP |
Rabbit Polyclonal Anti-NR0B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the N terminal of human NR0B1. Synthetic peptide located within the following region: MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVG |
Rabbit Polyclonal Anti-NR0B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the middle region of human NR0B1. Synthetic peptide located within the following region: FCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKS |
Rabbit Polyclonal Anti-Retinoic Acid Receptor beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Retinoic Acid Receptor beta Antibody: A synthesized peptide derived from human Retinoic Acid Receptor beta |
Rabbit Polyclonal Anti-NR4A3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A3 Antibody: A synthesized peptide derived from human NR4A3 |
Rabbit Polyclonal Anti-THR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THR1 Antibody: A synthesized peptide derived from human THR1 |
Rabbit Polyclonal Anti-HNF4alpha /gamma Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF4alpha /gamma Antibody: A synthesized peptide derived from human HNF4alpha /gamma |
Rabbit Polyclonal Anti-Phospho-Retinoic Acid Receptor alpha (Ser77) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-Retinoic Acid Receptor alpha (Ser77) Antibody: A synthesized peptide derived from human Retinoic Acid Receptor alpha around the phosphorylation site of Sersine 77 |
| Modifications | Phospho-specific |
Glucocorticoid Receptor (NR3C1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of Human GR |
Goat Polyclonal Antibody against RXRA
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CQVNSSLTSPTGRGSM, from the internal region of the protein sequence according to NP_002948.1. |
Rabbit Polyclonal antibody to Glucocorticoid Receptor beta (nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor))
| Applications | IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 265 of Glucocorticoid Receptor beta (Uniprot ID#P04150) |
Rabbit polyclonal antibody to Progesterone receptor (progesterone receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 18 and 112 of Progesterone Receptor (Uniprot ID#P06401) |
Rabbit polyclonal antibody to TR Alpha (thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian))
| Applications | IF, IP, WB |
| Reactivities | Human |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 317 and 490 of Thyroid Hormone Receptor alpha 2 (Uniprot ID#P10827) |
Rabbit Polyclonal Nurr1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide comprising residues 513-526 [TERHGLKEPKRVEE] of the human Nurr1 protein. Based on 100% sequence homology, this antibody is also expected to cross react with rat and mouse Nurr1. |
Rabbit polyclonal Estrogen Receptor-a (Ser102) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of serine 102 (L-N-SP-V-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal Androgen Receptor (Ab-213) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Androgen Receptor around the phosphorylation site of serine 213 (E-A-SP-G-A). |
Rabbit polyclonal GR (Ab-203) antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 203 (S-G-SP-P-G). |
Rabbit polyclonal GR (Ser203) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human GR around the phosphorylation site of serine 203 (S-G-SP-P-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-TRIP4 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TRIP4. |
Anti-ESR1 (Phospho-Ser118) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 118 (Q-L-S(p)-P-F) derived from Human Estrogen Receptor-a. |
| Modifications | Phospho-specific |
Germany
Japan
United Kingdom
China
