Mouse Monoclonal Antibody against Caspase 7
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Mouse Monoclonal Antibody against Caspase 7
Applications | WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Caspase-9 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Caspase-9 antibody was raised against a peptide corresponding to amino acids 41 to 56 of human caspase-9 . |
Rabbit Polyclonal Caspase-8 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Caspase-8 antibody was raised against a 15 amino acid peptide from near the carboxy terminus human caspase-8 isoform E. |
Mouse Monoclonal Caspase 9 Antibody (LAP6 96-2-22)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Goat Anti-Caspase 3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RDVSKEDHSKRS, from the internal region of the protein sequence according to NP_004337.2; NP_116786.1. |
Rabbit polyclonal anti-Calpain 1 antibody
Applications | WB |
Reactivities | Bovine, Human, Mouse, Rabbit, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 700 of rat Calpain 1 |
Rabbit Polyclonal Caspase-3 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Caspase-3 antibody was raised against a 17 amino acid synthetic peptide near the center of human Caspase-3. |
Goat Polyclonal Caspase 6 (alpha) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence NRKVSQRRVDFCKDP, from the internal region of the protein sequence according to NP_001217.2; NP_116787.1 |
Goat Polyclonal Caspase 6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QTEKLDTNITEVD, from the internal region of the protein sequence according to NP_001217.2; NP_116787.1 |
Anti-CASP8 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.221~225(T-L-D-K-V) derived from Human Caspase8. |
USD 450.00
5 Days
Mouse monoclonal anti-CASP3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal active/cleaved Caspase 8 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat, Gerbil |
Conjugation | Unconjugated |
Immunogen | Recombinant catalytically active human Caspase-8 protein was used as immunogen. |
Mouse Monoclonal Caspase-8 Antibody (FLICE 4-1-20)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Caspase-10/FLICE2 Antibody
Applications | WB |
Reactivities | Chicken, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to N-terminus of Human Caspase 10 |
Rabbit Polyclonal Anti-CAPN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CAPN1 antibody: synthetic peptide directed towards the N terminal of human CAPN1. Synthetic peptide located within the following region: EFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDL |
Mouse Monoclonal Caspase-9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Caspase-9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti Caspase 8 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A recombinant full length human caspase 8 protein |
Rabbit anti Caspase 6 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from C-terminus of human Caspase 6 protein. This sequence is identical to human rat and mouse species. |
Carrier-free (BSA/glycerol-free) CAPN2 mouse monoclonal antibody, clone OTI3G1 (formerly 3G1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CAPN2 mouse monoclonal antibody, clone OTI1F4 (formerly 1F4)
Applications | FC, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CFLAR mouse monoclonal antibody, clone OTI2D3 (formerly 2D3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CFLAR mouse monoclonal antibody, clone OTI2H3 (formerly 2H3)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CFLAR mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CFLAR mouse monoclonal antibody, clone OTI2H8 (formerly 2H8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CFLAR mouse monoclonal antibody, clone OTI1B1 (formerly 1B1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CASP3 mouse monoclonal antibody,clone OTI3A11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CASP3 mouse monoclonal antibody,clone OTI3A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CASP3 mouse monoclonal antibody,clone OTI7B8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CASP3 mouse monoclonal antibody,clone OTI1D2
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-CASP6 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 66-221 amino acids of human caspase 6, apoptosis-related cysteine peptidase |
Anti-CASP6 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 66-221 amino acids of human caspase 6, apoptosis-related cysteine peptidase |
Anti-CASP9 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 139-389 amino acids of Human Caspase-9 |
Anti-CASP9 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 139-389 amino acids of Human Caspase-9 |
Anti-CASP9 (active) Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 41-56 amino acids of human caspase 9, apoptosis-related cysteine peptidase |
Anti-CASP10 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 485-499 amino acids of Human caspase 10, apoptosis-related cysteine peptidase |
Anti-CASP3 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-269 amino acids of human caspase 3, apoptosis-related cysteine peptidase |
Anti-CASP3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-269 amino acids of human caspase 3, apoptosis-related cysteine peptidase |
Anti-CASP7 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 207-303 amino acids of human caspase 7, apoptosis-related cysteine peptidase |
Anti-CASP7 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 207-303 amino acids of human caspase 7, apoptosis-related cysteine peptidase |
Anti-CFLAR Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 201-218 amino acids of human CASP8 and FADD-like apoptosis regulator |
Anti-CAPN2 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 530-700 amino acids of Human Calpain-2 catalytic subunit |
Anti-CAPN2 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 530-700 amino acids of Human Calpain-2 catalytic subunit |
Anti-CAPN1 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 543-713 amino acids of Human Calpain-1 catalytic subunit |
Anti-CAPN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 543-713 amino acids of Human Calpain-1 catalytic subunit |
Anti-CASP10 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 228-522 amino acids of human caspase 10, apoptosis-related cysteine peptidase |
Rabbit Polyclonal Anti-CFLAR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CFLAR |
Rabbit Polyclonal Anti-CFLAR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CFLAR |
Rabbit Polyclonal Anti-CFLAR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CFLAR |
CASP10 Antibody - c-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the c-terminal region of Human CASP10 |