Goat Anti-Delta-Sarcoglycan (aa245-257) Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RLPHGSYTPTGTR, from the internal region of the protein sequence according to NP_000328.2; NP_758447.1; NP_001121681.1. |
Goat Anti-DAG1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HVGKHEYFMHATDK, from the internal region of the protein sequence according to NP_004384.3. |
Rabbit polyclonal ITGA5 (light chain, Cleaved-Glu895) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human ITGA5. |
Rabbit polyclonal Integrin beta3 (Tyr785) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Integrin β3 around the phosphorylation site of tyrosine 785 (I-T-YP-R-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-CACNG7 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CACNG7. |
Rabbit polyclonal anti-ADCY4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY4. |
ITGA3 / CD49c Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Monkey, Orang-Utan |
| Immunogen | ITGA3 / CD49c antibody was raised against synthetic 18 amino acid peptide from internal region of human ITGA3 / CD49c. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Monkey (100%); Gibbon, Galago, Hamster, Elephant, Rabbit, Guinea pig (94%); Marmoset, Mouse, Rat, Panda, Bovine, Bat, Horse (89%); Pig (83%). |
Rabbit polyclonal anti-TGF-beta2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed recombinant human TGF-β2 |
USD 195.00
5 Days
Mouse Anti-Human CD49e (Integrin alpha 5) Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human TNF alpha Purified (50 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-ITGA4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.1024~1028(Y-I-N-S-K) derived from Human LPAM-1(Integrin a4, CD49d). |
Anti-ATP2A2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 111-253 amino acids of human ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 |
Anti-ITGB3 (Phospho-Tyr785) Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 785 (I-T-Y(p)-R-G) derived from Human Integrin β3. |
| Modifications | Phospho-specific |
Anti-ITGAV Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1021-1034 amino acids of human integrin, alpha V |
Rabbit polyclonal anti-PLN antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLN antibody is generated from a rabbit immunized with a KLH conjugated synthetic peptide between 1-22 amino acids from the N-terminal region of human PLN. |
USD 450.00
5 Days
Mouse monoclonal anti-ITGB1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal Anti-CACNG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG1 antibody: synthetic peptide directed towards the N terminal of human CACNG1. Synthetic peptide located within the following region: SKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSL |
Rabbit polyclonal Anti-CACNG4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4. Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL |
Rabbit Polyclonal Anti-SLC8A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC8A1 Antibody is: synthetic peptide directed towards the N-terminal region of Human SLC8A1. Synthetic peptide located within the following region: CTGSYYCKKGVILPIWEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADR |
Rabbit Polyclonal Anti-SGCB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGCB antibody is: synthetic peptide directed towards the middle region of Human SGCB. Synthetic peptide located within the following region: RIGPNGCDSMELHESGLLRFKQVSDMGVIHPLYKSTVGGRRNENLVITGN |
Rabbit Polyclonal Anti-SGCB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SGCB antibody: synthetic peptide directed towards the middle region of human SGCB. Synthetic peptide located within the following region: FSTDYETHEFHLPSGVKSLNVQKASTERITSNATSDLNIKVDGRAIVRGN |
Rabbit Polyclonal Anti-Sgcd Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Sgcd antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FVLLLMILILVNLAMTIWILKVMNFTIDGMGNLRITEKGLKLEGDSEFLQ |
Rabbit Polyclonal Anti-ITGA8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITGA8 antibody: synthetic peptide directed towards the N terminal of human ITGA8. Synthetic peptide located within the following region: GEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGIPRGAQNFGYVSI |
Rabbit Polyclonal Anti-ADCY2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADCY2 antibody: synthetic peptide directed towards the middle region of human ADCY2. Synthetic peptide located within the following region: FLSDSEETIPPTANTTNTSFSASNNQVAILRAQNLFFLPYFIYSCILGLI |
Rabbit Polyclonal Anti-Cacng3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cacng3 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GDPGQRDSKKSYSYGWSFYFGAFSFIIAEIVGVVAVHIYIEKHQQLRARS |
Rabbit Polyclonal Anti-CACNG4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG4 antibody: synthetic peptide directed towards the N terminal of human CACNG4. Synthetic peptide located within the following region: GPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYL |
Rabbit Polyclonal Anti-CACNG6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNG6 antibody: synthetic peptide directed towards the N terminal of human CACNG6. Synthetic peptide located within the following region: RAHGQGRSGLTPEREGKVKLALLLAAVGATLAVLSVGTEFWVELNTYKAN |
Rabbit Polyclonal Anti-ITGB3 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ITGB3 / Integrin Beta 3 / CD61 antibody was raised against synthetic 19 amino acid peptide from N-terminus of human CD61. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset (95%); Hamster, Panda (89%); Mouse, Rabbit (84%). |
Rabbit Polyclonal Anti-ITGB3 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ITGB3 / Integrin Beta 3 / CD61 antibody was raised against synthetic 14 amino acid peptide from internal region of human CD61. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset (93%); Dog, Panda (86%). |
Rabbit Polyclonal Anti-ITGB1 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGB1 / Integrin Beta 1 / CD29 antibody was raised against synthetic 17 amino acid peptide from extracellular domain of human Integrin Beta 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Dog, Bat, Panda, Horse (94%); Sheep, Bovine, Cat, Elephant, Pig (88%). |
Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA2 / CD49b antibody was raised against synthetic 16 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Panda, Pig (100%); Bovine, Elephant, Horse, Chicken, Lizard (94%); Opossum, Turkey (88%); Bat, Hamster, Stickleback (81%). |
Rabbit Polyclonal Anti-ITGB1 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGB1 / Integrin Beta 1 / CD29 antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human Integrin Beta 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Sheep, Dog, Bovine, Cat, Elephant, Panda, Horse, Pig (100%); Platypus (93%); Bat, Opossum (86%). |
Rabbit Polyclonal Anti-CACNA1C Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CACNA1C / Cav1.2 antibody was raised against synthetic 16 amino acid peptide from internal region of human CACNA1C / Cav1.2. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey, Marmoset (94%). |
Rabbit Polyclonal Anti-CACNA1C Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | CACNA1C / Cav1.2 antibody was raised against synthetic 16 amino acid peptide from C-Terminus of human CACNA1C / Cav1.2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset (94%); Elephant (88%). |
Rabbit Polyclonal Anti-ITGA6 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ITGA6/Integrin Alpha 6/CD49f antibody was raised against synthetic 18 amino acid peptide from N-terminus of human ITGA6 / CD49f. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bat (100%); Mouse, Bovine, Dog, Hamster, Elephant, Panda, Horse (94%); Rat (89%); Opossum, Platypus (83%). |
Rabbit Polyclonal Anti-ITGA6 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ITGA6/Integrin Alpha 6/CD49f antibody was raised against synthetic 16 amino acid peptide from internal region of human ITGA6 / CD49f. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Guinea pig (100%); Elephant, Bat, Opossum, Platypus (94%). |
Rabbit Polyclonal Anti-ITGA6 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | ITGA6/Integrin Alpha 6/CD49f antibody was raised against synthetic 15 amino acid peptide from internal region of human ITGA6 / CD49f. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Horse (100%); Marmoset, Bovine, Bat, Pig (93%); Galago, Mouse, Opossum (87%); Rat, Hamster, Panda, Rabbit, Guinea pig (80%). |
Rabbit Polyclonal Anti-ITGA6 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA6/Integrin Alpha 6/CD49f antibody was raised against synthetic 18 amino acid peptide from N-terminus of human ITGA6 / CD49f. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse (100%); Platypus (94%); Opossum (89%); Turkey, Chicken (83%). |
Rabbit Polyclonal Anti-ITGA4 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA4 / VLA-4 / CD49d antibody was raised against synthetic 14 amino acid peptide from internal region of human ITGA4 / VLA-4. Percent identity with other species by BLAST analysis: Human (100%), Gorilla (100%), Gibbon (100%), Monkey (100%), Marmoset (100%), Mouse (100%), Rat (100%), Elephant (93%), Panda (93%), Dog (86%), Bat (86%), Bovine (86%), Rabbit (86%), Horse (86%), Pig (86%). |
Mouse Monoclonal Integrin beta 3(N-terminus) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-TNF-alpha Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-TNF-alpha Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rat monoclonal Anti-Integrin aVb6 Clone AvB6 53a.2
| Reactivities | Human |
| Conjugation | Unconjugated |
Rat monoclonal Anti-Integrin aVβ6 Clone Avβ6 62ow.17
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Integrin a2 Clone HAS-3
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-Integrin a2 Clone HAS-4
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-CD49b Clone 16B4
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse monoclonal Anti-CD49b Clone 31H4
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
