Rabbit Polyclonal Anti-GPR37 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR37 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR37. Synthetic peptide located within the following region: KIRKAEKACTRGNKRQIQLESQMNCTVVALTILYGFCIIPENICNIVTAY |
Rabbit Polyclonal Anti-UQCRC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UQCRC2 antibody is: synthetic peptide directed towards the C-terminal region of Human UQCRC2. Synthetic peptide located within the following region: GIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSV |
Rabbit Polyclonal Anti-VDAC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC2 antibody: synthetic peptide directed towards the N terminal of human VDAC2. Synthetic peptide located within the following region: VKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWN |
Rabbit Polyclonal Anti-VDAC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC3 antibody: synthetic peptide directed towards the N terminal of human VDAC3. Synthetic peptide located within the following region: SCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLTFTQKWNTDNTLGTE |
Rabbit Polyclonal Anti-SLC18A1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC18A1 antibody: synthetic peptide directed towards the N terminal of human SLC18A1. Synthetic peptide located within the following region: MNDTASTIPPPATEAISAHKNNCLQGTGFLEEEITRVGVLFASKAVMQLL |
Rabbit Polyclonal Anti-NDUFC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFC2 antibody: synthetic peptide directed towards the N terminal of human NDUFC2. Synthetic peptide located within the following region: IARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRP |
Rabbit Polyclonal Anti-COX7B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COX7B antibody: synthetic peptide directed towards the N terminal of human COX7B. Synthetic peptide located within the following region: MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCI |
Rabbit Polyclonal Anti-CYC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYC1 antibody: synthetic peptide directed towards the middle region of human CYC1. Synthetic peptide located within the following region: RWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP |
Rabbit Polyclonal Anti-ATP5H Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP5H antibody: synthetic peptide directed towards the C terminal of human ATP5H. Synthetic peptide located within the following region: CAEWVSLSKARIVEYEKEMEKMKNLIPFDQMTIEDLNEAFPETKLDKKKY |
Rabbit Polyclonal Anti-ND5 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-ND5 antibody: synthetic peptide directed towards the N terminal of human ND5. Synthetic peptide located within the following region: SIVASTFIISLFPTTMFMCLDQEVIISNWHWATTQTTQLSLSFKLDYFSM |
Rabbit polyclonal Anti-NDUFS3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFS3 antibody: synthetic peptide directed towards the middle region of human NDUFS3. Synthetic peptide located within the following region: ANHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQ |
Rabbit polyclonal Anti-NDUFS3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFS3 antibody: synthetic peptide directed towards the middle region of human NDUFS3. Synthetic peptide located within the following region: EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK |
Rabbit polyclonal Anti-Ndufs1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ndufs1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Ndufs1. Synthetic peptide located within the following region: VVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGEC |
Rabbit polyclonal Anti-NDUFS1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFS1 antibody: synthetic peptide directed towards the middle region of human NDUFS1. Synthetic peptide located within the following region: TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE |
Rabbit polyclonal Anti-PPID Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPID antibody: synthetic peptide directed towards the middle region of human PPID. Synthetic peptide located within the following region: AECGELKEGDDGGIFPKDGSGDSHPDFPEDADIDLKDVDKILLITEDLKN |
Rabbit Polyclonal Anti-NDUFA8 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ndufa8 antibody is: synthetic peptide directed towards the middle region of Mouse Ndufa8. Synthetic peptide located within the following region: KEFMLCRWEEKDPRRCLKEGKLVNGCALNFFRQIKSHCAEPFTEYWTCLD |
Rabbit Polyclonal Anti-NDUFA3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ndufa3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ndufa3. Synthetic peptide located within the following region: ISPYTKYASMINKATPYNYPVPVRDDGNMPDVPSHPQDPLGPSLDWLKNL |
Rabbit Polyclonal Anti-NDUFB10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFB10 antibody is: synthetic peptide directed towards the C-terminal region of NDUFB10. Synthetic peptide located within the following region: KVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDL |
Rabbit anti Cytochrome C Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti Synuclein alpha Polyclonal Antibody
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Rabbit anti Ubiquitin Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to C-term of ubiquitin protein. |
Rabbit anti LRRK2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to C-terminus of human LRRK2. |
Rabbit anti LRRK2(pS1124) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti LRRK2(Paired S1124) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti LRRK2(pT1491) Polyclonal Antibody
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti LRRK2(Paired T1491) Polyclonal Antibody
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti LRRK2(pT1503) Polyclonal Antibody
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti LRRK2(paired T1503) Polyclonal Antibody
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti Synuclein Alpha (pS129) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti LRRK2(pS955) Polyclonal Antibody
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti LRRK2(paired S955) Polyclonal Antibody
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti LRRK2(pS973) Polyclonal Antibody
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti LRRK2(paired S973) Polyclonal Antibody
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-SLC25A4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 40-52 amino acids of human solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 4 |
Anti-CASP9 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 139-389 amino acids of Human Caspase-9 |
Anti-CASP9 (active) Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 41-56 amino acids of human caspase 9, apoptosis-related cysteine peptidase |
Anti-SLC18A2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 500-514 amino acids of human solute carrier family 18 (vesicular monoamine), member 2 |
Anti-APAF1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 11-25 amino acids of Human Apoptotic protease-activating factor 1 |
Anti-APAF1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 8-20 amino acids of Human apoptotic peptidase activating factor 1 |
Anti-CASP3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-269 amino acids of human caspase 3, apoptosis-related cysteine peptidase |
Anti-VDAC1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 185-197 amino acids of human voltage-dependent anion channel 1 |
Anti-COX5B Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-139 amino acids of human cytochrome c oxidase subunit Vb |
Anti-COX6B1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Germany
Japan
United Kingdom
China
