Primary Antibodies

View as table Download

Rabbit anti-HSPA9 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HSPA9

Rabbit Anti-NSE (Neuron specific enolase) Antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant human NSE expressed in and purified from E. coli

Rabbit anti-ENO1 Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ENO1

Rabbit Polyclonal Anti-WDR61 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen WDR61 antibody was raised against a 14 amino acid peptide near the amino terminus of human WDR61.

Rabbit Polyclonal Anti-SLC1A7 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen SLC1A7 antibody was raised against a 14 amino acid peptide near the carboxy terminus of human SLC1A7.

Rabbit polyclonal ENOA Antibody (N-term)

Applications FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This ENOA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-60 amino acids from the N-terminal region of human ENOA.

Rabbit Polyclonal Anti-EXOSC4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC4 antibody: synthetic peptide directed towards the N terminal of human EXOSC4. Synthetic peptide located within the following region: SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE

Rabbit Polyclonal Anti-LSM2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM2 antibody: synthetic peptide directed towards the middle region of human LSM2. Synthetic peptide located within the following region: TDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Rabbit Polyclonal Anti-EXOSC6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC6 antibody: synthetic peptide directed towards the N terminal of human EXOSC6. Synthetic peptide located within the following region: MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAK

Rabbit Polyclonal Anti-RQCD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RQCD1 antibody is: synthetic peptide directed towards the middle region of Human RQCD1. Synthetic peptide located within the following region: SLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQK

Rabbit Polyclonal Anti-ENO3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3. Synthetic peptide located within the following region: EVDLHTAKGRFRAAVPSGASTGIYEALELRDGDKGRYLGKGVLKAVENIN

Rabbit Polyclonal Anti-WNT5 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen WNT5 antibody was raised against a 15 amino acid peptide near the center of human WNT5B.

Rabbit anti-HSPD1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HSPD1

Rabbit Polyclonal Anti-LSM4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM4 antibody: synthetic peptide directed towards the middle region of human LSM4. Synthetic peptide located within the following region: GRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGK

Rabbit Polyclonal Anti-EXOSC2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC2 antibody: synthetic peptide directed towards the N terminal of human EXOSC2. Synthetic peptide located within the following region: RKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSV

Rabbit Polyclonal Anti-EXOSC7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7. Synthetic peptide located within the following region: LEKPNEGYLEFFVDCSASATPEFEGRGGDDLGTEIANTLYRIFNNKSSVD

Rabbit Polyclonal Anti-EXOSC7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC7 antibody: synthetic peptide directed towards the N terminal of human EXOSC7. Synthetic peptide located within the following region: EVETDVVSNTSGSARVKLGHTDILVGVKAEMGTPKLEKPNEGYLEFFVDC

Rabbit Polyclonal Anti-EXOSC3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the C terminal of human EXOSC3. Synthetic peptide located within the following region: PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

Rabbit Polyclonal Anti-EXOSC10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC10 antibody: synthetic peptide directed towards the C terminal of human EXOSC10. Synthetic peptide located within the following region: FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG

Rabbit Polyclonal Anti-EXOSC3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the middle region of human EXOSC3. Synthetic peptide located within the following region: TKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFK

Rabbit Polyclonal Anti-ENO3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3. Synthetic peptide located within the following region: MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR

Rabbit Polyclonal PAPOLA Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAPOLA antibody: human PAPOLA (polyA polymerase alpha), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein.

Rabbit anti-MTR4 Polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human MTR4

Rabbit Polyclonal Anti-EXOSC10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC10 antibody: synthetic peptide directed towards the C-terminal region of human EXOSC10. Synthetic peptide located within the following region: ACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKP

Rabbit Polyclonal Anti-CNOT7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNOT7 antibody: synthetic peptide directed towards the N terminal of human CNOT7. Synthetic peptide located within the following region: TEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPP

Rabbit Polyclonal Anti-POLS Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-POLS antibody: synthetic peptide directed towards the N terminal of human POLS. Synthetic peptide located within the following region: VVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVK

Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8)

Rabbit polyclonal anti-NSE / ENO2 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human NSE.

Rabbit polyclonal anti-HSP60 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HSP60.

Rabbit polyclonal anti-HSPD1(HSP60) antibody(Center), Loading control

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-215 amino acids from the Central region of human HSPD1.

Rabbit anti-LSM4 Polyclonal Antibody

Applications IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human LSM4

Rabbit Polyclonal Anti-CNOT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNOT3 antibody: synthetic peptide directed towards the C terminal region of human CNOT3. Synthetic peptide located within the following region: MMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDL

Rabbit Polyclonal Anti-LSM6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM6 antibody: synthetic peptide directed towards the N terminal of human LSM6. Synthetic peptide located within the following region: MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEE

Rabbit Polyclonal Anti-XRN1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XRN1 antibody: synthetic peptide directed towards the middle region of human XRN1. Synthetic peptide located within the following region: LPQEISQVNQHHKSGFNDNSVKYQQRKHDPHRKFKEECKSPKAECWSQKM

NSE (ENO2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen Peptide mapping at the C-terminus of NSE of human origin

Grp75 (HSPA9) (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to C-Terminus of Human GRP75.

NSE (ENO2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide from Human NSE.
Epitope: C-terminus.

Goat Polyclonal Antibody against DEAD-box protein 6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-AEYHSEPVEDEKP, from the C Terminus of the protein sequence according to NP_004388.1.

Rabbit Polyclonal antibody to ENO1 (enolase 1, (alpha))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 199 and 434 of ENO1 (Uniprot ID#P06733)

Rabbit polyclonal CAF-1 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CAF-1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 34-61 amino acids from the N-terminal region of human CAF-1.

Rabbit polyclonal CNOT8 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CNOT8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 227-255 amino acids from the C-terminal region of human CNOT8.

Rabbit polyclonal ENO1 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This ENO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 178-205 amino acids from the Central region of human ENO1.

Rabbit Polyclonal Anti-LSM6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM6 antibody: synthetic peptide directed towards the middle region of human LSM6. Synthetic peptide located within the following region: YRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRR

Rabbit Polyclonal Anti-EXOSC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXOSC2 antibody: synthetic peptide directed towards the middle region of human EXOSC2. Synthetic peptide located within the following region: AEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCG

Rabbit Polyclonal Anti-LSM1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM1 antibody: synthetic peptide directed towards the middle region of human LSM1. Synthetic peptide located within the following region: SDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDE

Rabbit Polyclonal Anti-DIS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-DIS3 antibody is: synthetic peptide directed towards the N-terminal region of Human DIS3. Synthetic peptide located within the following region: QTVLQEVRNRSAPVYKRIRDVTNNQEKHFYTFTNEHHRETYVEQEQGENA

Rabbit Polyclonal Anti-DIS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DIS3 antibody: synthetic peptide directed towards the N terminal of human DIS3. Synthetic peptide located within the following region: DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML

Rabbit Polyclonal Anti-CNOT6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNOT6 antibody: synthetic peptide directed towards the N terminal of human CNOT6. Synthetic peptide located within the following region: EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN

Rabbit Polyclonal Anti-EXOSC3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EXOSC3 antibody is: synthetic peptide directed towards the C-terminal region of Human EXOSC3. Synthetic peptide located within the following region: RNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFK

Rabbit Polyclonal Anti-LSM8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LSM8 antibody: synthetic peptide directed towards the N terminal of human LSM8. Synthetic peptide located within the following region: MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ