Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
CCL5 / RANTES Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal NFkB p65 phospho S536 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding S536 of human p65 (RelA) protein. |
Rabbit Polyclonal NF- kappaB p65 (Ser536) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p65 around the phosphorylation site of Serine 536 |
| Modifications | Phospho-specific |
IKBKB Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IKBKB |
TBK1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TBK1 |
Rabbit Polyclonal NF-kappaB p65 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF-kappaB p65 |
Rabbit anti-IFNB1 Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNB1 |
Rabbit anti-CCL5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CCL5 |
Rabbit Polyclonal Anti-Interleukin 1β Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Interleukin 1β Antibody: A synthesized peptide derived from human Interleukin 1β |
IL1 beta (IL1B) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, FN, WB |
| Reactivities | Chicken |
| Immunogen | Recombinaint Chicken IL-1B |
Rabbit polyclonal IKK-gamma (Ser85) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 85 (Q-A-SP-Q-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal IKK-gamma (Ab-85) antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IKK-? around the phosphorylation site of serine 85 (Q-A-SP-Q-R) |
Rabbit polyclonal IKK-alpha (Ser176)/IKK-beta (Phospho-Ser177) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-a around the phosphorylation site of serine 176/177 (Q-G-SP-L-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal NF-kB p65 (Ab-311) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human NF-?B p65 around the phosphorylation site of serine 311 (F-K-SP-I-M). |
Rabbit polyclonal IkB-a (Tyr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human I?B-a around the phosphorylation site of tyrosine 305 (L-P-YP-D-D). |
| Modifications | Phospho-specific |
Rabbit polyclonal NF-kB p105/p50 (Ser893) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NF-?B p105/p50 around the phosphorylation site of serine 893. |
| Modifications | Phospho-specific |
Anti-NFKBIA rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-317 amino acids of human nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha |
Anti-NFKBIA (Phospho-Ser32/Ser36) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 32/36 (H-D-S(p)-G-L-D-S(p)-M-K) derived from Human I?B-a. |
| Modifications | Phospho-specific |
Rabbit anti-IL1B Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL1B |
Rabbit Polyclonal RIP3/RIPK3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to amino acids 497-522 (isoform CRA_a, 518 amino acids) and 298-335 (isoform CRA_b, 319 amino acids) of human RIP3 was used as immunogen for this antibody. |
Rabbit Polyclonal Anti-MAVS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAVSantibody: synthetic peptide directed towards the C terminal of human VISA. Synthetic peptide located within the following region: VAENPSIQLLEGNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQ |
Rabbit Polyclonal Anti-ADAR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADAR antibody: synthetic peptide directed towards the C terminal of human ADAR. Synthetic peptide located within the following region: RMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTFHDQIAMLSHR |
Rabbit Polyclonal Anti-POLR3H Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR3H antibody: synthetic peptide directed towards the middle region of human POLR3H. Synthetic peptide located within the following region: AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL |
Rabbit Polyclonal Anti-POLR3F Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR3F antibody: synthetic peptide directed towards the N terminal of human POLR3F. Synthetic peptide located within the following region: MAEVKVKVQPPDADPVEIENRIIELCHQFPHGITDQVIQNEMPHIEAQQR |
Rabbit Polyclonal Anti-POLR3A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR3A antibody: synthetic peptide directed towards the middle region of human POLR3A. Synthetic peptide located within the following region: AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT |
Rabbit Polyclonal Anti-POLR1D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR1D antibody: synthetic peptide directed towards the middle region of human POLR1D. Synthetic peptide located within the following region: TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF |
Rabbit Polyclonal Anti-POLR3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLR3B antibody: synthetic peptide directed towards the C terminal of human POLR3B. Synthetic peptide located within the following region: IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED |
Mouse Monoclonal IKKβ Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NF-kB p65 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NF-?B p65 Antibody: A synthesized peptide derived from human NF-?B p65 |
Rabbit Polyclonal Anti-Caspase 1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Caspase 1 Antibody: A synthesized peptide derived from human Caspase 1 |
Rabbit Polyclonal Anti-Caspase 1 (Phospho-Ser376) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Caspase 1 (Phospho-Ser376) Antibody: A synthesized peptide derived from human Caspase 1 (Phospho-Ser376) |
| Modifications | Phospho-specific |
IP10 (CXCL10) mouse monoclonal antibody, clone B-C50, Azide Free
| Applications | FC |
| Reactivities | Human |
IP10 (CXCL10) mouse monoclonal antibody, clone B-C55, Azide Free
| Reactivities | Human |
Active filters
Pathways
- Cytosolic DNA-sensing pathway
Filter by
Category
Target Symbol
- TMEM173 (64)
- RIPK3 (57)
- RELA (54)
- IL6 (42)
- IKBKG (41)
- IRF3 (40)
- NFKB1 (36)
- RIPK1 (35)
- NFKBIA (30)
- IKBKE (28)
- PYCARD (27)
- CHUK (26)
- DDX58 (24)
- MAVS (24)
- IL1B (23)
- IKBKB (20)
- CASP1 (17)
- CCL5 (16)
- POLR3GL (14)
- NFKBIB (13)
- IL33 (12)
- POLR3H (12)
- AIM2 (10)
- IFNB1 (10)
- ADAR (9)
- CXCL10 (9)
- IFNA2 (7)
- POLR3C (7)
- IFNA6 (6)
- IRF7 (6)
- TBK1 (6)
- IL18 (4)
- POLR3A (4)
- POLR3F (4)
- CCL4 (3)
- ZBP1 (3)
- IFNA16 (2)
- IFNA4 (2)
- POLR1C (2)
- POLR3B (2)
- POLR3D (2)
- CCL4L1 (1)
- IFNA1 (1)
- IFNA13 (1)
- IFNA17 (1)
- IFNA5 (1)
- IFNA7 (1)
- IFNA8 (1)
- POLR1D (1)
- POLR3G (1)
- TREX1 (1)