Germany
Japan
United Kingdom
China
Antibodies
View as table Download
PPP2R1A rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH |
PPP2R1B rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH |
Calcineurin A (PPP3CA) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A peptide conjugated to KLH |
PPP6C rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | KLH conjugated peptide corresponding to the C-terminal peptide of PPV catalytic subunit. |
PPP4C rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | A PP X/C peptide conjugated to KLH |
PPP1A (PPP1CA) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
SHP2 (PTPN11) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide mapping at the C-terminal of Human SHP-2 |
Rabbit Polyclonal Antibody against CTDSP1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CTDSP1-V250 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 235-261 amino acids from the C-terminal region of human CTDSP1-V250. |
Rabbit Polyclonal Antibody against PPM1F (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PPM1F antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 11-40 amino acids from the N-terminal region of human PPM1F. |
Rabbit anti-PTEN (Phospho-Ser380/Thr382/Thr383) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse and Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanPTEN around the phosphorylation site of serine 380 and threonine 382/383(R-Y-SP-D-TP-TP-D-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal PTEN(Ab-380/382/383) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of Serine 380 and Threonine 382/383. |
Rabbit polyclonal CDC25A (Ser75) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | H:S76, M:S74, R:S76 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25A around the phosphorylation site of Ser75 |
| Modifications | Phospho-specific |
Rabbit polyclonal CDC25A (Ser178) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC25A around the phosphorylation site of serine 178 (Q-N-SP-A-P). |
| Modifications | Phospho-specific |
Anti-PTPN11 (Phospho-Tyr542) Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 542 (H-E-Y(p)-T-N) derived from Human SHP-2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal CDC25A (Ser75) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CDC25A around the phosphorylation site of Sersine 75. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-EYA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EYA3 antibody: synthetic peptide directed towards the middle region of human EYA3. Synthetic peptide located within the following region: QSRKNMTSKNRGKRKADATSSQDSELERVFLWDLDETIIIFHSLLTGSYA |
Rabbit Polyclonal Anti-CDC25B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASS |
Rabbit polyclonal MKP1 (Ser359) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MKP1 around the phosphorylation site of serine 359 (L-Q-SP-P-I). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-PPP1R1C antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PPP1R1C. |
FAP-1 / PTPN13 Rabbit Polyclonal (aa2451-2466) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | FAP-1 / PTPN13 antibody was raised against synthetic peptide from human PTPN13. |
PTPRA Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit |
| Immunogen | PTPRA / RPTP-Alpha antibody was raised against synthetic 17 amino acid peptide from cytoplasmic domain of human PTPRA. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Hamster, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Rat (94%); Elephant, Turkey, Chicken (88%); Xenopus (82%). |
PTPRM Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Hamster, Horse, Human, Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | PTPRM / PTP Mu antibody was raised against synthetic 18 amino acid peptide from internal region of human PTPRM. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Mouse, Rat, Hamster, Panda, Horse, Rabbit, Opossum (100%); Marmoset, Bovine, Bat (94%). |
PTPRR Rabbit Polyclonal (aa249-265) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | PTPRR antibody was raised against synthetic peptide from human PTPRR. |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Families
- Phosphatase
Filter by
Category
Target Symbol
- CDC25A (7)
- PTEN (6)
- PTPN11 (6)
- DUSP1 (5)
- PTPRM (5)
- PTPN13 (4)
- PTPRE (4)
- CDC25B (3)
- DUSP26 (3)
- DUSP4 (3)
- DUSP6 (3)
- PPP1CB (3)
- PPP2CA (3)
- PPP3CA (3)
- PTP4A2 (3)
- PTPRC (3)
- PTPRJ (3)
- SET (3)
- ACP1 (2)
- CDC25C (2)
- CTDSP1 (2)
- DUSP12 (2)
- DUSP22 (2)
- DUSP23 (2)
- DUSP8 (2)
- MTMR4 (2)
- PDP1 (2)
- PPM1F (2)
- PPP1CA (2)
- PPP1CC (2)
- PPP2CB (2)
- PPP2R1B (2)
- PPP3CC (2)
- PPP4C (2)
- PPP6C (2)
- PTPN20 (2)
- PTPRK (2)
- SIRPA (2)
- SSH3 (2)
- ACPP (1)
- CDKN3 (1)
- CTDSP2 (1)
- CTDSPL (1)
- DAPP1 (1)
- DUSP10 (1)
- DUSP11 (1)
- DUSP13 (1)
- DUSP14 (1)
- DUSP15 (1)
- DUSP16 (1)
- DUSP19 (1)
- DUSP2 (1)
- DUSP3 (1)
- DUSP7 (1)
- DUSP9 (1)
- EYA1 (1)
- EYA3 (1)
- EYA4 (1)
- ILKAP (1)
- MTMR2 (1)
- MTMR7 (1)
- MTMR9 (1)
- PPFIA1 (1)
- PPM1H (1)
- PPM1K (1)
- PPM1L (1)
- PPP1R1C (1)
- PPP2R1A (1)
- PPP2R2A (1)
- PPP2R2B (1)
- PPP2R3A (1)
- PPP3CB (1)
- PPP3R2 (1)
- PTN (1)
- PTPN1 (1)
- PTPN12 (1)
- PTPN2 (1)
- PTPN22 (1)
- PTPN3 (1)
- PTPN4 (1)
- PTPN5 (1)
- PTPN6 (1)
- PTPN7 (1)
- PTPRA (1)
- PTPRR (1)
Reactivities
Conjugates
Modifications
Pathways
- MAPK signaling pathway (33)
- Oocyte meiosis (24)
- Tight junction (16)
- Wnt signaling pathway (15)
- Long-term potentiation (14)
- Natural killer cell mediated cytotoxicity (14)
- Focal adhesion (13)
- Adherens junction (12)
- Cell cycle (12)
- Progesterone-mediated oocyte maturation (12)
- T cell receptor signaling pathway (11)
- B cell receptor signaling pathway (9)
- Regulation of actin cytoskeleton (9)
- Cell adhesion molecules (CAMs) (8)
- Insulin signaling pathway (8)
- Long-term depression (8)
- TGF-beta signaling pathway (8)
- Alzheimer's disease (7)
- Amyotrophic lateral sclerosis (ALS) (7)
- Apoptosis (7)
- Axon guidance (7)
- Calcium signaling pathway (7)
- Jak-STAT signaling pathway (7)
- VEGF signaling pathway (7)
- Vascular smooth muscle contraction (7)
- Adipocytokine signaling pathway (6)
- Chronic myeloid leukemia (6)
- Endometrial cancer (6)
- Epithelial cell signaling in Helicobacter pylori infection (6)
- Glioma (6)
- Inositol phosphate metabolism (6)
- Leukocyte transendothelial migration (6)
- Melanoma (6)
- Neurotrophin signaling pathway (6)
- Pathways in cancer (6)
- Phosphatidylinositol signaling system (6)
- Prostate cancer (6)
- Renal cell carcinoma (6)
- Small cell lung cancer (6)
- p53 signaling pathway (6)
- Riboflavin metabolism (5)
- Fc gamma R-mediated phagocytosis (3)
- Primary immunodeficiency (3)
- Fructose and mannose metabolism (2)
- Metabolic pathways (2)
- Thiamine metabolism (2)