Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-FZD7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
MMP9 rabbit monoclonal antibody, clone EP1255Y, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Guinea Pig, Human |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Rabbit polyclonal MITF (Ab-180/73) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M). |
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-FZD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
Rabbit polyclonal antibody to MC1R (melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 253 and 317 of MC1 Receptor (Uniprot ID#Q01726) |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-WNT5A Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal Raf1 (Ab-621) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
| Modifications | Phospho-specific |
MEK1 (MAP2K1) (N-term) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Xenopus |
| Immunogen | MAP2K1 antibody was raised against synthetic peptide derived from sequence near the amino-terminus of human MEK1, conjugated to KLH |
SCF (KITLG) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hSCF (anti-hSCF). |
SCF (KITLG) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (>98%) recombinant hSCF. |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Families
- Druggable Genome
Pathways
- Melanogenesis
Filter by
Category
Target Symbol
- CTNNB1 (14)
- CREB1 (13)
- MAP2K1 (13)
- RAF1 (10)
- GSK3B (8)
- PRKCA (8)
- GNAS (7)
- KIT (6)
- POMC (6)
- WNT10B (6)
- CAMK2A (5)
- CREBBP (5)
- EP300 (5)
- KITLG (5)
- WNT1 (5)
- CAMK2B (4)
- EDN1 (4)
- MAP2K2 (4)
- MAPK1 (4)
- PLCB3 (4)
- WNT3A (4)
- ADCY1 (3)
- ADCY5 (3)
- BMP2 (3)
- FZD8 (3)
- FZD9 (3)
- MAPK3 (3)
- MC1R (3)
- MITF (3)
- NRAS (3)
- ADCY4 (2)
- DVL2 (2)
- EDNRB (2)
- FZD1 (2)
- FZD2 (2)
- FZD3 (2)
- FZD4 (2)
- FZD5 (2)
- FZD6 (2)
- GNAO1 (2)
- HRAS (2)
- LEF1 (2)
- PRKACA (2)
- PRKACG (2)
- PRKCB (2)
- PRKX (2)
- WNT4 (2)
- WNT5A (2)
- WNT7A (2)
- ADCY3 (1)
- ADCY6 (1)
- ADCY7 (1)
- ADCY8 (1)
- CALM1 (1)
- CALM2 (1)
- CAMK2G (1)
- DVL1 (1)
- DVL3 (1)
- FZD10 (1)
- FZD7 (1)
- GNAI1 (1)
- GNAI3 (1)
- PLCB1 (1)
- PLCB2 (1)
- PRKACB (1)
- PRKCG (1)
- TCF7 (1)
- TCF7L1 (1)
- TYRP1 (1)