Rabbit Polyclonal Anti-F2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
USD 515.00
In Stock
Rabbit Polyclonal Anti-MASP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK |
Rabbit anti-CFB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CFB |
Rabbit anti-KLKB1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KLKB1 |
C3 rabbit polyclonal antibody, Serum
| Applications | ID, IHC, IP |
| Reactivities | Human |
| Immunogen | C3c is the major fragment resulting from the C3 cleavage by C3 convertase and factor i. It is composed of an intact beta chain bound to two fragments of the alpha chain. The protein is isolated and purified from pooled normal human serum by precipitation techniques, followed by chromatographical methods. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit polyclonal anti-C1S antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human C1S.Purification: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen. |
Rabbit polyclonal PLG Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PLG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 636-665 amino acids from the C-terminal region of human PLG. |
Factor XII (F12) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 13~43 amino acids from the N-terminal region of human F12 |
Rabbit polyclonal antibody to Factor VII (coagulation factor VII (serum prothrombin conversion accelerator))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 209 and 466 of Factor VII (Uniprot ID#P08709) |
Anti-F9 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 227-461 amino acids of human coagulation factor IX |
Anti-PLAT Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-267 amino acids of human plasminogen activator, tissue |
Anti-F7 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from C terminal 250 amino acids of human coagulation factor VII (serum prothrombin conversion accelerator) |
Anti-PLAU Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 179-417 amino acids of human plasminogen activator, urokinase |
Germany
Japan
United Kingdom
China
