Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
USD 380.00
In Stock
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit anti-IFNAR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNAR1 |
CD40 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Rabbit Anti-Human TLR5 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TLR5 antibody was raised against synthetic peptide from human TLR5. |
Rabbit Polyclonal TLR3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | TLR3 antibody was raised against a peptide corresponding to 15 amino acids near the carboxy terminus of human TLR3. The immunogen is located within amino acids 780 - 830 of TLR3. |
Rabbit Polyclonal TLR5 Antibody
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat, Porcine |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against KLH-conjugated synthetic peptide corresponding to a portion of human TLR5 found between amino acids 300-350. It will cross-react with mouse and rat TLR5. |
Rabbit Polyclonal Anti-CD80 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CD80 antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human CD80. The immunogen is located within amino acids 60 - 110 of CD80. |
Rabbit Polyclonal Anti-CD86 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CD86 antibody was raised against a peptide corresponding to 17 amino acids near the center of human CD86. The immunogen is located within amino acids 160 - 210 of CD86. |
Rabbit Polyclonal anti-TLR2 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLR2 antibody: synthetic peptide directed towards the C terminal of human TLR2. Synthetic peptide located within the following region: LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRAAIKS |
Rabbit Polyclonal anti-TLR6 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TLR6 antibody: synthetic peptide directed towards the middle region of human TLR6. Synthetic peptide located within the following region: KCLVRVFQFLWPKPVEYLNIYNLTIIESIREEDFTYSKTTLKALTIEHIT |
Rabbit Polyclonal TLR4 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TLR4 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of human TLR4. |
Rabbit Polyclonal TLR8 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TLR8 antibody was raised against a 13 amino acid synthetic peptide near the amino terminus of human TLR8. The immunogen is located within the first 50 amino acids of TLR8. |
Rabbit Polyclonal TLR8 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | TLR8 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human TLR8. The immunogen is located within the last 50 amino acids of TLR8. |
Anti-TLR8 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human toll-like receptor 8 |
Anti-TLR7 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 62-348 amino acids of Human Toll-like receptor 7 |
Anti-TLR7 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 62-348 amino acids of Human Toll-like receptor 7 |
Rabbit Monoclonal CD14 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TLR2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TLR2 |
Germany
Japan
United Kingdom
China
