Rabbit Polyclonal Anti-CUL3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CUL3 |
Rabbit Polyclonal Anti-CUL3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CUL3 |
PML Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PML |
Rabbit Polyclonal Anti-SOCS1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
UBE2I Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UBE2I |
BRCA1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human BRCA1 |
Rabbit anti-BIRC2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BIRC2 |
Rabbit anti-UBE2C Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UBE2C |
Rabbit anti-KEAP1 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human KEAP1 |
Rabbit anti-SIAH1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SIAH1 |
Rabbit polyclonal anti-TRI18/MID1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TRI18. |
Rabbit polyclonal Parkin Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This Parkin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 387-417 amino acids from the C-terminal region of human Parkin. |
PARK2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PARK2 |
Rabbit Polyclonal Anti-APC3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APC3 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human APC3. |
Rabbit Polyclonal Anti-DEPTOR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR. |
Rabbit Polyclonal XIAP Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | XIAP antibody was raised against a synthetic peptide corresponding to 13 amino acids at the C-terminus of human XIAP. The immunogen is located within amino acids 420 - 470 of XIAP. |
Rabbit polyclonal TTK (Ab-676) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V). |
Anti-SKP1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 163 amino acids of human S-phase kinase-associated protein 1 |
Rabbit polyclonal anti-Cullin 1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cullin 1. |
Rabbit polyclonal anti-Cullin 2 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cullin 2. |
Rabbit Polyclonal PIAS3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PIAS3 antibody was raised against a 12 amino acid synthetic peptide near the carboxy terminus of human PIAS3. |
Rabbit anti-UBE2D1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UBE2D1 |
Rabbit anti-PIAS2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PIAS2 |
Rabbit Polyclonal cIAP Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | c-IAP antibody was raised against a synthetic peptide corresponding to 14 amino acids at the C-terminus of human c-IAP1 c-IAP antibody detects both c-IAP1 and c-IAP2. |
Rabbit Polyclonal antibody to DDB1 (damage-specific DNA binding protein 1, 127kDa)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 749 and 1140 of DDB1 (Uniprot ID#Q16531) |
Rabbit polyclonal CDC16/APC6 (Ab-560) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P). |
Rabbit polyclonal anti-UBE1L / UBA7 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human UBE1L. |
Rabbit polyclonal MAP3K1 (Thr1402) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP3K1 around the phosphorylation site of threonine 1402 (K-G-TP-G-A). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-UBR5 / EDD antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human EDD. |
Anti-TRAF6 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 350-522 amino acids of human TNF receptor-associated factor 6, E3 ubiquitin protein ligase |
Anti-TRIM32 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human tripartite motif containing 32 |
Rabbit polyclonal Parkin antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Parkin antibody. |
Rabbit polyclonal PIAS1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PIAS1. |
Rabbit polyclonal PIAS3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PIAS3. |
Rabbit Polyclonal Anti-RNF7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RNF7 |
Rabbit Polyclonal UBE2S Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region (NM_014501). |
Rabbit Polyclonal UBC13 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | UBC13 antibody was raised against a peptide corresponding to 15 amino acids near the C-terminus of human UBC13. |
Rabbit polyclonal ITCH (Tyr420) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITCH around the phosphorylation site of tyrosine 420 (F-I-YP-G-N). |
Modifications | Phospho-specific |
Rabbit polyclonal CDC16/APC6 (Ser560) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-APC1 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human APC1. |
Rabbit Polyclonal PIAS1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PIAS1 antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human PIAS1. |
Rabbit Polyclonal APC6 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | APC6 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human APC6. |
Rabbit Polyclonal PIAS2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PIAS2 antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human PIAS2. |
Rabbit Polyclonal APC10 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APC10 antibody was raised against a 16 amino acid synthetic peptide near the center of human APC10. |
Rabbit Polyclonal APC4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APC4 antibody was raised against a 14 amino acid synthetic peptide near the amino terminus of human APC4. |
Rabbit Polyclonal APC5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APC5 antibody was raised against a 17 amino acid synthetic peptide near the center of human APC5. |
Rabbit polyclonal SYVN1 (HRD1) Antibody (C-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SYVN1 (HRD1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 586-617 amino acids from the C-terminal region of human SYVN1 (HRD1). |
Rabbit polyclonal FBXW11 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This FBXW11 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-196 amino acids from the Central region of human FBXW11. |
Rabbit anti-TRAF6 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TRAF6 |
CUL1 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CUL1 |
Rabbit Polyclonal Anti-PRPF19 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRPF19 antibody: synthetic peptide directed towards the middle region of human PRPF19. Synthetic peptide located within the following region: PSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVK |