Rabbit polyclonal CCL2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CCL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the C-terminal region of human CCL2. |
p38 (MAPK14) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide mapping to the N-terminus of human p38 MAP kinase |
p38 (MAPK14) pThr180/pTyr182 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic phospho-peptide surrounding amino acid Thr180/Tyr182 of human p38 MAP kinase. |
GRP94 (HSP90B1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Chicken, Drosophila, Human, Monkey, Mouse, Rat |
| Immunogen | Synthetic peptide. |
GRP94 (HSP90B1) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
IKK gamma (IKBKG) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
HSP90AA1 rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rabbit, Rat |
| Immunogen | Recombinant human Hsp90 R protein |
CARD4 (NOD1) (C-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide - KLH conjugated |
Rabbit polyclonal antibody to IKK beta (inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 493 and 739 of IKK beta (Uniprot ID#O14920) |
Rabbit Polyclonal antibody to Caspase 8 (caspase 8, apoptosis-related cysteine peptidase)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 217 of Caspase 8 (Uniprot ID#Q14790) |
Rabbit polyclonal antibody to IkappaB-alpha (nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 317 of IKB alpha (Uniprot ID#P25963) |
Rabbit polyclonal IKK-gamma (Ser376) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 376 (Y-L-SP-S-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal HSP90B (Ser254) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal NF-kB p65(Ab-276) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human NF-?B p65 around the phosphorylation site of Serine 276. |
Rabbit polyclonal NF-kB p65 (Ser281) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NF-kB p65 around the phosphorylation site of serine 281 (E-L-SP-E-P) |
| Modifications | Phospho-specific |
Rabbit polyclonal Caspase 1 (Cleaved-Asp210) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 1. |
Rabbit polyclonal IkB-beta (Ser23) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Ser23, Mouse: Ser23, Rat: Ser23 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human I?B-β around the phosphorylation site of serine 23. |
| Modifications | Phospho-specific |
Rabbit polyclonal HSP90B1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSP90B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 460-487 amino acids from the Central region of human HSP90B1. |
Rabbit polyclonal MAPK14 Antibody (Center T180/Y182)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 158-192 amino acids from the Central region of human MAPK14. |
Rabbit polyclonal MAPK1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human MAPK1. |
Rabbit polyclonal MAPK3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3. |
Rabbit polyclonal MAPK1 Antibody (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 254-285 amino acids from the C-terminal region of human MAPK1. |
Rabbit polyclonal HSP90AB1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 697-724 amino acids from the C-terminal region of human HSP90AB1. |
Rabbit polyclonal HSP90AB1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 438-465 amino acids from the Central region of human HSP90AB1. |
Rabbit Polyclonal Anti-MAP3K7IP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP3K7IP2 antibody: synthetic peptide directed towards the N terminal of human MAP3K7IP2. Synthetic peptide located within the following region: QKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDLNFSDDSG |
Germany
Japan
United Kingdom
China
