Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal TLR5 Antibody
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat, Porcine |
| Conjugation | Unconjugated |
| Immunogen | This antibody was developed against KLH-conjugated synthetic peptide corresponding to a portion of human TLR5 found between amino acids 300-350. It will cross-react with mouse and rat TLR5. |
Rabbit polyclonal beta-Catenin (Ser37) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human β-Catenin around the phosphorylation site of serine 37 (I-H-SP-G-A). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-HCLS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HCLS1 antibody: synthetic peptide directed towards the N terminal of human HCLS1. Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP |
Rabbit Polyclonal Anti-HCLS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HCLS1 antibody: synthetic peptide directed towards the N terminal of human HCLS1. Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP |
Rabbit Polyclonal Anti-YWHAQ Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YWHAQ antibody: synthetic peptide directed towards the N terminal of human YWHAQ. Synthetic peptide located within the following region: SVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSIC |
Rabbit Polyclonal beta Tubulin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a portion of amino acids 400-450 of human b-tubulin was used as immunogen for this antibody, GenBank no. gi|27227551|gb|AAN85571.1|. |
Rabbit anti Tubulin beta Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to aa 416-430 of human tubulin beta. This sequence is identical among human, rat, mouse, bovine, guinea pig, chicken, gerbil, frog, yeast, fungi, sea urchin, Myxamoeba and plasmodium. |
Rabbit anti Tubulin alpha Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to aa 426-450 of human tubulin. This sequence is identical among human, rat, mouse, bovine, guinea pig, gerbil, frog and chicken. |
Anti-KRT18 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 130-430 amino acids of human keratin 18 |
Anti-PRKCA rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha |
Anti-pan CDH Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to C terminal 22 amino acids of human pan-cadherin |
Anti-CLDN1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 196-209 amino acids of Human claudin 1 |
Anti-YWHAQ Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 140-154 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide |
Anti-YWHAQ Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 140-154 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide |
Anti-ROCK1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1115-1354 amino acids of human Rho-associated, coiled-coil containing protein kinase 1 |
Anti-ROCK2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human Rho-associated, coiled-coil containing protein kinase 2 |
Anti-TUBB3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 57-294 amino acids of Human Tubulin beta-3 chain |
Anti-NCK1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a C terminal 300 amino acids of human NCK adaptor protein 1 |
Anti-TUBA4A Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 127-447 amino acids of Human Tubulin alpha-4A chain |
Rabbit Polyclonal Anti-LY96 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human LY96 |
Rabbit Polyclonal Anti-ARPC4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ARPC4 |
Rabbit Polyclonal Anti-KYNU Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human FYN |
Active filters
Reactivities
- Mouse
Applications
- IHC
Antibody Hosts
- Rabbit
Pathways
- Pathogenic Escherichia coli infection
Filter by
Category
Target Symbol
- ACTB (6)
- PRKCA (5)
- ROCK2 (5)
- TLR4 (5)
- TUBA1A (5)
- CDH1 (4)
- CLDN1 (4)
- CTNNB1 (4)
- YWHAZ (4)
- ABL1 (3)
- HCLS1 (3)
- LY96 (3)
- SHC1 (3)
- TLR5 (3)
- TUBA4A (3)
- TUBB (3)
- YWHAQ (3)
- ARPC2 (2)
- CTTN (2)
- EZR (2)
- FYN (2)
- ITGB1 (2)
- KRT18 (2)
- NCK1 (2)
- ROCK1 (2)
- TUBA1C (2)
- TUBB3 (2)
- ACTG1 (1)
- ARHGEF2 (1)
- ARPC1A (1)
- ARPC4 (1)
- CDC42 (1)
- NCK2 (1)
- NCL (1)
- TUBA1B (1)
- TUBA3C (1)
- TUBB2B (1)
- WASL (1)