Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-GPX4 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPX4 antibody: synthetic peptide directed towards the middle region of human GPX4. Synthetic peptide located within the following region: QUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAA |
Rabbit Polyclonal Anti-GPX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI |
Rabbit Polyclonal Anti-CYP4F3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4F3 antibody: synthetic peptide directed towards the N terminal of human CYP4F3. Synthetic peptide located within the following region: LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF |
Rabbit Polyclonal Anti-CYP4A22 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ |
Rabbit Polyclonal Anti-PTGDS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTGDS antibody: synthetic peptide directed towards the N terminal of human PTGDS. Synthetic peptide located within the following region: MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS |
Rabbit Polyclonal Anti-PGDS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGDS antibody: synthetic peptide directed towards the N terminal of human PGDS. Synthetic peptide located within the following region: EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME |
Glutathione Peroxidase 1 (GPX1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 164-193aa) of human Glutathione peroxidase 1 / GPX1. |
USD 450.00
2 Weeks
GGT1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GGT1 |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | PGES / PTGES antibody was raised against synthetic 16 amino acid peptide from N-Terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Rabbit, Pig (100%); Hamster, Bovine (94%); Dog, Horse, Turkey, Chicken (88%); Pike (81%). |
Rabbit polyclonal CYP2B6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP2B6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 235-263 amino acids from the Central region of human CYP2B6. |
Rabbit polyclonal PTGS1 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PTGS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 571-599 amino acids from the C-terminal region of human PTGS1. |
Rabbit polyclonal ALOX12 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ALOX12 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 618-650 amino acids from the C-terminal region of human ALOX12. |
USD 370.00
2 Weeks
Rabbit polyclonal antibody to Cytochrome P450 4A11 (cytochrome P450, family 4, subfamily A, polypeptide 11)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 48 and 316 of CYP4A11 (Uniprot ID#Q02928) |
Rabbit polyclonal Cytochrome P450 2C8 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8. |
| Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 4F2 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human Cytochrome P450 4F2. |
Rabbit polyclonal AKR1C3 Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This AKR1C3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 107-135 amino acids from the Central region of human AKR1C3. |
Rabbit polyclonal CYP2E1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP2E1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 402-429 amino acids from the C-terminal region of human CYP2E1. |
Cytochrome P450 2E1 (CYP2E1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide mapping at the C-terminal of human P450ⅡE1 |
COX2 (PTGS2) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of Human COX-2 |
PGES / PTGES Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Chicken, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | PGES / PTGES antibody was raised against synthetic 14 amino acid peptide from near N-terminus of human PTGES. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Rat, Bovine, Dog, Elephant, Panda, Rabbit, Horse, Pig, Opossum, Turkey, Chicken, Platypus, Pufferfish, Zebrafish, Stickleback (100%); Mouse, Xenopus, Pike (93%). |
Rabbit polyclonal anti-PLA2G4E antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PLA2G4E. |
PLA2G3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Immunogen | PLA2G3 antibody was raised against synthetic 16 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Rat, Dog, Hamster (94%); Elephant, Panda, Rabbit (88%); Bovine, Horse, Pig (81%). |
Active filters
Applications
- IHC
Antibody Hosts
- Rabbit
Pathways
- Arachidonic acid metabolism
Filter by
Category
Target Symbol
- PTGS1 (8)
- CYP2E1 (5)
- PTGDS (4)
- PTGS2 (4)
- EPHX2 (3)
- GGT1 (3)
- TBXAS1 (3)
- AKR1C3 (2)
- ALOX12 (2)
- ALOX15B (2)
- ALOX5 (2)
- CBR1 (2)
- CYP2B6 (2)
- CYP2C19 (2)
- CYP2C8 (2)
- CYP2J2 (2)
- CYP4A11 (2)
- GPX1 (2)
- PLA2G3 (2)
- PLA2G6 (2)
- PTGES (2)
- ALOX12B (1)
- ALOX15 (1)
- CBR3 (1)
- CYP2C9 (1)
- CYP4A22 (1)
- CYP4F2 (1)
- CYP4F3 (1)
- GPX2 (1)
- GPX3 (1)
- GPX4 (1)
- GPX7 (1)
- HPGDS (1)
- LTA4H (1)
- PLA2G2D (1)
- PLA2G4A (1)
- PLA2G4E (1)
- PTGES2 (1)
- PTGIS (1)