Germany
Japan
United Kingdom
China
USD 428.00
In Stock
Antibodies
Download
Rabbit monoclonal anti-ST13 Antibody, clone OTIR191G8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PHB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHB |
TA349430 is a possible alternative to TA322982.
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit polyclonal anti-MBTPS1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
Rabbit Polyclonal Anti-NOTCH2 (Cleaved-Ala1734) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOTCH2 (Cleaved-Ala1734) Antibody: A synthesized peptide derived from human NOTCH2 (Cleaved-Ala1734) |
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Aqp2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Aqp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLV |
Active filters
Reactivities
- Mouse
Applications
- WB
Antibody Hosts
- Rabbit
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Druggable Genome
Availabilities
- In Stock
Filter by
Target Symbol
- EGFR (17)
- MAPT (17)
- AKT1 (16)
- EZR (13)
- JUN (13)
- NR3C1 (12)
- ATF2 (10)
- RELA (10)
- SRC (10)
- GRIN2B (9)
- MAPK14 (9)
- MET (9)
- PAK1 (9)
- RPS6KB1 (9)
- BRAF (8)
- CHUK (8)
- CREB1 (8)
- FGFR1 (8)
- FOXO1 (8)
- IRS1 (8)
- PRKCA (8)
- PRKCD (8)
- PTK2 (8)
- PTPN11 (8)
- RAF1 (8)
- STAT5A (8)
- CCNB1 (7)
- CDK2 (7)
- CTNNB1 (7)
- ERBB2 (7)
- ESR1 (7)
- MAP2K1 (7)
- MAP2K4 (7)
- MAPK3 (7)
- PPP1R1B (7)
- RUNX1 (7)
- SNCA (7)
- ABL1 (6)
- BCL2L1 (6)
- CDC25A (6)
- CSF1R (6)
- DPYSL2 (6)
- GSK3A (6)
- HDAC1 (6)
- IGF1R (6)
- JAK2 (6)
- NFKBIA (6)
- NOS3 (6)
- RPS6KA5 (6)
- SMAD1 (6)
- SMAD3 (6)
- STAT1 (6)
- AGT (5)
- APP (5)
- BAD (5)
- BLNK (5)
- CASP3 (5)
- CASP7 (5)
- CDK1 (5)
- CDKN1A (5)
- CFLAR (5)
- DNM1 (5)
- DUSP1 (5)
- ELK1 (5)
- EPHA2 (5)
- GAB2 (5)
- HDAC2 (5)
- LMNA (5)
- MAP3K7 (5)
- MAPK8 (5)
- MTOR (5)
- NGFR (5)
- PAK2 (5)
- PDCD4 (5)
- PDGFRB (5)
- PLCG1 (5)
- POMC (5)
- PXN (5)
- RB1 (5)
- SHC1 (5)
- SNAI1 (5)
- SRF (5)
- STAT3 (5)
- STAT5B (5)
- STX1A (5)
- SYK (5)
- TH (5)
- TNNI3 (5)
- ACACA (4)
- AHR (4)
- AKAP8 (4)
- AKR1B1 (4)
- ALDOB (4)
- BCAR1 (4)
- BMX (4)
- CAMK2A (4)
- CASP9 (4)
- CBL (4)
- CCND3 (4)
- CD44 (4)
Clonalities
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (518)
- MAPK signaling pathway (358)
- Focal adhesion (311)
- Neurotrophin signaling pathway (271)
- ErbB signaling pathway (259)
- Prostate cancer (240)
- Chemokine signaling pathway (227)
- Metabolic pathways (225)
- Regulation of actin cytoskeleton (223)
- Chronic myeloid leukemia (213)
- Insulin signaling pathway (196)
- T cell receptor signaling pathway (192)
- Pancreatic cancer (190)
- Colorectal cancer (189)
- Glioma (164)
- Cell cycle (163)
- Acute myeloid leukemia (161)
- Toll-like receptor signaling pathway (161)
- GnRH signaling pathway (159)
- Melanoma (151)
- Epithelial cell signaling in Helicobacter pylori infection (150)
- Fc gamma R-mediated phagocytosis (150)
- B cell receptor signaling pathway (149)
- Small cell lung cancer (148)
- Non-small cell lung cancer (144)
- VEGF signaling pathway (144)
- Adherens junction (142)
- Progesterone-mediated oocyte maturation (140)
- Renal cell carcinoma (140)
- Wnt signaling pathway (139)
- Cytokine-cytokine receptor interaction (138)
- Fc epsilon RI signaling pathway (138)
- Leukocyte transendothelial migration (135)
- Adipocytokine signaling pathway (134)
- Endometrial cancer (134)
- Natural killer cell mediated cytotoxicity (134)
- Apoptosis (133)
- Neuroactive ligand-receptor interaction (133)
- Axon guidance (129)
- Calcium signaling pathway (129)
- Alzheimer's disease (125)
- Jak-STAT signaling pathway (124)
- Endocytosis (117)
- Gap junction (114)
- Bladder cancer (110)
- Oocyte meiosis (110)
- Melanogenesis (109)
- Long-term potentiation (103)
- Vascular smooth muscle contraction (103)
- Tight junction (101)
- NOD-like receptor signaling pathway (92)
- p53 signaling pathway (87)
- Huntington's disease (85)
- Amyotrophic lateral sclerosis (ALS) (83)
- Long-term depression (81)
- RIG-I-like receptor signaling pathway (77)
- mTOR signaling pathway (77)
- TGF-beta signaling pathway (76)
- Pathogenic Escherichia coli infection (71)
- Type II diabetes mellitus (67)
- Thyroid cancer (56)
- Ubiquitin mediated proteolysis (50)
- Hypertrophic cardiomyopathy (HCM) (49)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (46)
- Parkinson's disease (46)
- Dorso-ventral axis formation (45)
- Dilated cardiomyopathy (43)
- Hematopoietic cell lineage (43)
- Prion diseases (42)
- Cytosolic DNA-sensing pathway (41)
- Viral myocarditis (40)
- Vibrio cholerae infection (38)
- Glycolysis / Gluconeogenesis (37)
- Phosphatidylinositol signaling system (35)
- Notch signaling pathway (31)
- Basal cell carcinoma (30)
- Purine metabolism (28)
- ECM-receptor interaction (27)
- Fructose and mannose metabolism (25)
- Cell adhesion molecules (CAMs) (24)
- Primary immunodeficiency (24)
- Arginine and proline metabolism (23)
- Pyruvate metabolism (23)
- Antigen processing and presentation (22)
- Base excision repair (22)
- PPAR signaling pathway (22)
- ABC transporters (21)
- Inositol phosphate metabolism (19)
- Nucleotide excision repair (19)
- SNARE interactions in vesicular transport (18)
- Glycerolipid metabolism (17)
- Lysosome (17)
- Olfactory transduction (17)
- Systemic lupus erythematosus (17)
- Hedgehog signaling pathway (16)
- Metabolism of xenobiotics by cytochrome P450 (16)
- Nitrogen metabolism (16)
- Pyrimidine metabolism (16)
- Pentose phosphate pathway (15)
- Renin-angiotensin system (15)
- Cardiac muscle contraction (14)
- DNA replication (14)
- Galactose metabolism (14)
- Tyrosine metabolism (14)
- Valine (14)
- Drug metabolism - cytochrome P450 (13)
- Homologous recombination (13)
- Mismatch repair (13)
- Retinol metabolism (13)
- Alanine (12)
- Butanoate metabolism (12)
- Complement and coagulation cascades (12)
- aspartate and glutamate metabolism (12)
- leucine and isoleucine degradation (12)
- Amino sugar and nucleotide sugar metabolism (11)
- Androgen and estrogen metabolism (11)
- Citrate cycle (TCA cycle) (11)
- Regulation of autophagy (11)
- Tryptophan metabolism (11)
- Oxidative phosphorylation (10)
- Propanoate metabolism (10)
- Fatty acid metabolism (9)
- Maturity onset diabetes of the young (9)
- Starch and sucrose metabolism (9)
- Taste transduction (9)
- Type I diabetes mellitus (9)
- Arachidonic acid metabolism (8)
- Cysteine and methionine metabolism (8)
- Glutathione metabolism (8)
- Histidine metabolism (8)
- Non-homologous end-joining (8)
- Drug metabolism - other enzymes (7)
- Phenylalanine metabolism (7)
- Proteasome (7)
- beta-Alanine metabolism (7)
- Basal transcription factors (6)
- Glycerophospholipid metabolism (6)
- Glycine (6)
- Pentose and glucuronate interconversions (6)
- Primary bile acid biosynthesis (6)
- serine and threonine metabolism (6)
- Fatty acid biosynthesis (5)
- Linoleic acid metabolism (5)
- Ribosome (5)
- Sphingolipid metabolism (5)
- Ascorbate and aldarate metabolism (4)
- C21-Steroid hormone metabolism (4)
- Folate biosynthesis (4)
- Lysine degradation (4)
- Porphyrin and chlorophyll metabolism (4)
- RNA degradation (4)
- Taurine and hypotaurine metabolism (4)
- leucine and isoleucine biosynthesis (4)
- Asthma (3)
- Autoimmune thyroid disease (3)
- Circadian rhythm - mammal (3)
- Limonene and pinene degradation (3)
- Methane metabolism (3)
- One carbon pool by folate (3)
- Other glycan degradation (3)
- Pantothenate and CoA biosynthesis (3)
- Selenoamino acid metabolism (3)
- Steroid biosynthesis (3)
- Aminoacyl-tRNA biosynthesis (2)
- Biosynthesis of unsaturated fatty acids (2)
- Ether lipid metabolism (2)
- Glyoxylate and dicarboxylate metabolism (2)
- Nicotinate and nicotinamide metabolism (2)
- Spliceosome (2)
- Terpenoid backbone biosynthesis (2)
- Vitamin B6 metabolism (2)
- Allograft rejection (1)
- Chondroitin sulfate biosynthesis (1)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Graft-versus-host disease (1)
- Heparan sulfate biosynthesis (1)
- N-Glycan biosynthesis (1)
- Phenylalanine (1)
- Riboflavin metabolism (1)
- Synthesis and degradation of ketone bodies (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- alpha-Linolenic acid metabolism (1)
- tyrosine and tryptophan biosynthesis (1)