USD 428.00
In Stock
Rabbit monoclonal anti-WT1 Antibody, clone OTIR5F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 428.00
In Stock
Rabbit monoclonal anti-WT1 Antibody, clone OTIR5F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-UCHL1 Antibody, clone OTIR2F11
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal anti-HSP90AA1(HSP90) antibody, Loading control
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HSP90AA1 |
Rabbit monoclonal anti-ST13 Antibody, clone OTIR191G8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
Applications | Dot, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
Modifications | Phospho-specific |
MSH6 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MSH6 |
Rabbit Polyclonal Anti-FGF9 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FGF9 |
Rabbit Polyclonal Anti-CTSL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CTSL |
Rabbit Polyclonal Anti-CUL3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CUL3 |
Rabbit Polyclonal Anti-DKK3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DKK3 |
Rabbit Polyclonal Anti-MAPK7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MAPK7 |
Rabbit Polyclonal Anti-DUSP10 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DUSP10 |
Rabbit Polyclonal Anti-EDN3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human EDN3 |
Rabbit Polyclonal Anti-RDX Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RDX |
Rabbit Polyclonal Anti-GNB5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GNB5 |
Rabbit Polyclonal Anti-GAS2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GAS2 |
Rabbit Polyclonal Anti-HCK Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HCK |
Rabbit Polyclonal Anti-ILK Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ILK |
Rabbit Polyclonal Anti-ING2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ING2 |
Rabbit Polyclonal Anti-ITGB3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ITGB3 |
Rabbit Polyclonal Anti-IRAK3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IRAK3 |
Rabbit Polyclonal Anti-LMNA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LMNA |
Rabbit Polyclonal Anti-MYL6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MYL6 |
Rabbit Polyclonal Anti-OAS2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human OAS2 |
Rabbit Polyclonal Anti-SERPINE2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SERPINE2 |
Rabbit Polyclonal Anti-PAK2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PAK2 |
Rabbit Polyclonal Anti-PHB Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PHB |
Rabbit Polyclonal Antibody against SR-BI
Applications | IF, IHC, WB |
Reactivities | Hamster, Human, Mink, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A C-terminal peptide containing residues from mouse Scavenger Receptor-BI (within residues 450-509). |
Rabbit Polyclonal p53DINP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | p53DINP1 antibody was raised with a synthetic peptide corresponding to 14 amino acids near the amino terminus of human p53DINP1. |
Rabbit polyclonal PFKFB2 (Ab-483) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-NOD1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NOD1 |
Rabbit anti-AHCY Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AHCY |
Rabbit Monoclonal Antibody against NOTCH1 (Clone EP1238Y)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Cow |
Conjugation | Unconjugated |
Rabbit Monoclonal Antibody against SOD2 (Clone EPR2560Y)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit monoclonal antibody against CD13(clone EPR4058)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
Applications | WB |
Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit polyclonal IRS-1 (Ab-312) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Rabbit Polyclonal PAK2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | PAK2 antibody was raised against a 14 amino acid peptide from near the amino terminus of human PAK2. |
Rabbit Anti-NMDA NR2B Subunit Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit polyclonal anti-MBTPS1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
BTK Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human BTK |
Rabbit Polyclonal Anti-NOTCH2 (Cleaved-Ala1734) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NOTCH2 (Cleaved-Ala1734) Antibody: A synthesized peptide derived from human NOTCH2 (Cleaved-Ala1734) |
Rabbit Polyclonal Anti-OLIG2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | OLIG2 antibody was raised against a 15 amino acid peptide near the amino terminus of human OLIG2. |
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
Modifications | Phospho-specific |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
Modifications | Phospho-specific |
Anti-EXT1 Rabbit Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human exostosin glycosyltransferase 1 |
Rabbit Polyclonal Anti-Aqp2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Aqp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLV |
Rabbit Polyclonal Anti-TLR4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TLR4 |