Rabbit Polyclonal antibody to ALPPL2 (alkaline phosphatase, placental-like 2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 46 and 344 of ALPPL2 (Uniprot ID#P10696) |
Rabbit polyclonal ALPL Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ALPL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 217-246 amino acids from the Central region of human ALPL. |
Rabbit Polyclonal antibody to SPR (sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase))
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 65 and 261 of SPR (Uniprot ID#P35270) |
Rabbit anti-DHFR Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DHFR |
Anti-DHFR Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit anti-QDPR Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human QDPR |
Rabbit polyclonal antibody to alkaline phosphatase(intestinal) (alkaline phosphatase, intestinal)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 3 and 206 of Alkaline phosphatase (intestinal) (Uniprot ID#P09923) |
Rabbit polyclonal anti-ALPL antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ALPL. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-GGH antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GGH. |
Rabbit polyclonal antibody to alkaline phosphatase (liver/bone/kidney) (alkaline phosphatase, liver/bone/kidney)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 359 of Alkaline Phosphatase (Tissue Non-Specific) (Uniprot ID#P05186) |
Rabbit polyclonal Alkaline Phosphatase (ALPI) Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Alkaline Phosphatase (ALPI) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 274-304 amino acids from the Central region of human Alkaline Phosphatase (ALPI). |
Rabbit Polyclonal Anti-GCH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCH1 antibody: synthetic peptide directed towards the C terminal of human GCH1. Synthetic peptide located within the following region: LRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLT |
Rabbit polyclonal Alkaline Phosphatase antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Alkaline Phosphatase [Human Intestine] |
Rabbit polyclonal Alkaline Phosphatase antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Alkaline Phosphatase [Human Intestine] |
Rabbit Polyclonal anti-ALPPL2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALPPL2 antibody: synthetic peptide directed towards the N terminal of human ALPPL2. Synthetic peptide located within the following region: MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQT |
Rabbit Polyclonal anti-ALPPL2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ALPPL2 antibody: synthetic peptide directed towards the middle region of human ALPPL2. Synthetic peptide located within the following region: SESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV |
Rabbit Polyclonal Anti-GCH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GCH1 antibody is: synthetic peptide directed towards the N-terminal region of Human GCH1. Synthetic peptide located within the following region: PPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQR |
Rabbit Polyclonal Anti-SPR Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SPR |
Germany
Japan
United Kingdom
China
