Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166) |
Rabbit Polyclonal Antibody against ATG5
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit Polyclonal Anti-UCHL3 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the N terminal of human UCHL3. Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC |
Rabbit Polyclonal Anti-UCHL5 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL5 antibody: synthetic peptide directed towards the middle region of human UCHL5. Synthetic peptide located within the following region: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK |
Rabbit polyclonal anti-TBP antibody, Loading control
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This TBP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 210-239 amino acids from the Central region of human TBP. |
Rabbit polyclonal EN2 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This EN2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-271 amino acids from the C-terminal region of human EN2. |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Rabbit polyclonal METTL2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This METTL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 329-359 amino acids from the C-terminal region of human METTL2. |
Rabbit polyclonal Mib1/Mindbomb Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Mib1/Mindbomb antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human Mib1/Mindbomb. |
Rabbit Polyclonal Anti-PTBP1 Antibody
| Applications | WB |
| Reactivities | Bovine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish, Dog, Pig, Horse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTBP1 antibody: synthetic peptide directed towards the middle region of human PTBP1. Synthetic peptide located within the following region: KGFKFFQKDRKMALIQMGSVEEAVQALIDLHNHDLGENHHLRVSFSKSTI |
Rabbit polyclonal antibody to VPS11 (vacuolar protein sorting 11 homolog (S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 300 and 392 of VPS11 (Uniprot ID#Q9H270) |
Rabbit polyclonal antibody to DMC1 (DMC1 dosage suppressor of mck1 homolog, meiosis-specific homologous recombination (yeast))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of DMC1 (Uniprot ID#Q14565) |
Rabbit polyclonal antibody to PSMC3 (proteasome (prosome, macropain) 26S subunit, ATPase, 3)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 51 and 361 of PSMC3 (Uniprot ID#P17980) |
Rabbit Polyclonal antibody to ARAF (v-raf murine sarcoma 3611 viral oncogene homolog)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 371 and 554 of A-RAF (Uniprot ID#P10398) |
Rabbit polyclonal antibody to PSMB8 (proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 52 and 276 of PSMB8 (Uniprot ID#P28062) |
Rabbit Polyclonal antibody to Transmembrane protein 147 (transmembrane protein 147)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 37 and 131 of Transmembrane protein 147 (Uniprot ID#Q9BVK8) |
Rabbit polyclonal beta Catenin antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus. |
Rabbit polyclonal MAPK14 Antibody (Center T180/Y182)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MAPK14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 158-192 amino acids from the Central region of human MAPK14. |
Rabbit polyclonal Anti-RAB5B Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB5B antibody: synthetic peptide directed towards the N terminal of human RAB5B. Synthetic peptide located within the following region: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE |
Rabbit Polyclonal antibody to TCP1 theta (chaperonin containing TCP1, subunit 8 (theta))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 111 and 367 of TCP1 theta (Uniprot ID#P50990) |
Rabbit Polyclonal antibody to GNAT2 (guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 154 and 354 of GNAT2 (Uniprot ID#P19087) |
Rabbit polyclonal anti-SMAD3 antibody
| Applications | IHC, WB |
| Reactivities | Human, Xenopus, Xenopus Tropicalis, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein. |
Rabbit Polyclonal anti-FOSL2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FOSL2 antibody: synthetic peptide directed towards the middle region of human FOSL2. Synthetic peptide located within the following region: PMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPISIAGGFY |
Rabbit Polyclonal Anti-GSR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP |
Rabbit polyclonal Anti-RAB5A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB5A antibody: synthetic peptide directed towards the middle region of human RAB5A. Synthetic peptide located within the following region: KTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCS |
Rabbit polyclonal antibody to VPAC2 (vasoactive intestinal peptide receptor 2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 334 and 423 of VPAC2 |
Rabbit polyclonal antibody to Axin 1 (axin 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 800 and 862 of AXIN1 (Uniprot ID#O15169) |
Rabbit polyclonal antibody to Thymidylate synthetase (thymidylate synthetase)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 122 and 313 of Thymidylate synthetase (Uniprot ID#P04818) |
Rabbit polyclonal ECT2 phospho T790 antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Chimpanzee, Chicken, Human, Mouse, Rat, Zebrafish, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 785-795 of human ECT2 protein. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Alpha-tubulin Antibody (biotin)
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rabbit, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Biotin-Alpha-tubulin antibody was raised against an 18 amino acid peptide near the carboxy terminus of human alpha-tubulin |
Germany
Japan
United Kingdom
China
