Rabbit Polyclonal Anti-PDE4D Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PDE4D |
Rabbit Polyclonal Anti-PDE4D Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PDE4D |
Rabbit Polyclonal Anti-NME5 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NME5 |
Rabbit Polyclonal antibody to PDE6D (phosphodiesterase 6D, cGMP-specific, rod, delta)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of PDE6D (Uniprot ID#O43924) |
Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 23 and 218 of HPRT (Uniprot ID#P00492) |
Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 218 of HPRT (Uniprot ID#P00492) |
Rabbit Polyclonal Anti-NME7 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NME7 |
Rabbit Polyclonal Anti-POLR1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR1B antibody: synthetic peptide directed towards the middle region of human POLR1B. Synthetic peptide located within the following region: SDKFQVRTTGARDRVTNQPIGGRNVQGGIRFGEMERDALLAHGTSFLLHD |
Rabbit Polyclonal Anti-BACE1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human BACE1 |
Rabbit Polyclonal antibody to PNPase (polyribonucleotide nucleotidyltransferase 1)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 25 and 251 of PNPase (Uniprot ID#Q8TCS8) |
Rabbit polyclonal antibody to PRPS1L1 (phosphoribosyl pyrophosphate synthetase 1-like 1)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 318 of PRPS1L1 (Uniprot ID#P21108) |
Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908) |
Rabbit Polyclonal PKM2 Antibody
Applications | WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to the internal region of human PKM2 protein (within residues 350-450). [Swiss-Prot# P14618] |
Rabbit polyclonal anti-FHIT antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human FHIT. |
Rabbit polyclonal POLR2A (Ab-1619) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human POLR2A around the phosphorylation site of serine 1619 (P-T-S-P-S). |
Rabbit Polyclonal nm23-H1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal Adenylate Kinase 1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit polyclonal anti-Adenylate Kinase 1/KAD1 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KAD1. |
Rabbit polyclonal anti-ADCY5/6 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY5/6. |
Rabbit polyclonal DNA Polymerase a antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human DNA Polymerase a. |
Rabbit polyclonal anti-NT5C1A antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NT5C1A. |
Phosphodiesterase 7b / PDE7B Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | PDE7B antibody was raised against synthetic 17 amino acid peptide from near N-terminus of human PDE7B. Percent identity with other species by BLAST analysis: Human (100%); Gibbon, Monkey (94%); Gorilla, Mouse, Rat, Elephant, Horse, Rabbit (88%); Opossum (82%). |
Rabbit polyclonal anti-NM23 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human NM23. |
Rabbit polyclonal anti-PDE4C antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PDE4C. |
Rabbit polyclonal anti-AMPD1 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AMPD1. |
Rabbit polyclonal anti-RPC4 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPC4. |
Rabbit polyclonal anti-PRIM1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human PRIM1. |
Rabbit polyclonal anti-POLE4 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLE4. |
Rabbit polyclonal anti-PNPT1 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PNPT1. |
Rabbit polyclonal anti-POLR3H (RPC8) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPC8. |
Anti-NPR1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 525-541 amino acids of Human natriuretic peptide receptor A/guanylate cyclase A (atrionatriuretic peptide receptor A) |
Rabbit polyclonal RPC3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RPC3. |
Rabbit Polyclonal DCK Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal NUDT5 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Anti-AK1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-194 amino acids of Human Adenylate kinase isoenzyme 1 |
Anti-AK1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-194 amino acids of Human Adenylate kinase isoenzyme 1 |
Anti-NME6 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-ENPP3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 850-864 amino acids of Human ectonucleotide pyrophosphatase/phosphodiesterase 3 |
Anti-ENPP3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 850-864 amino acids of Human ectonucleotide pyrophosphatase/phosphodiesterase 3 |
Anti-PKM2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 11-221 amino acids of Human Pyruvate kinase isozymes M1/M2 |
Anti-PKM2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 11-221 amino acids of Human Pyruvate kinase isozymes M1/M2 |
Anti-NME3 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-NME3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-RRM1 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 226 amino acids of human ribonucleotide reductase M1 |
Anti-RRM1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 226 amino acids of human ribonucleotide reductase M1 |
Anti-ADSL Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human adenylosuccinate lyase |
Anti-ADA rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human adenosine deaminase |
Anti-FHIT Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-FHIT Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-ADCY4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 808-1077 amino acids of human adenylate cyclase 4 |
Anti-ADCY4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 808-1077 amino acids of human adenylate cyclase 4 |