Germany
Japan
United Kingdom
China
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Antibodies
View as table Download
Rabbit Polyclonal Aggrecan Neoepitope Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit Polyclonal Antibody against ATG5
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Rabbit Polyclonal AGPAT6 Antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human AGPAT6 protein sequence (between residues 400-456). [Swiss-Prot Q86UL3] |
Rabbit Polyclonal Antibody against SAT1
| Applications | WB |
| Reactivities | Human, Mouse, Porcine, Xenopus, Hamster, Cow, Rat, Chicken |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region within residues 100-171 of the human protein. [Swiss-Prot# P21673] |
Rabbit Polyclonal Ki-67/MKI67 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of human Ki67 (within residues 1550-1700) [Swiss-Prot# P46013] |
TA336650 is a possible alternative to TA336566.
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit Polyclonal Antibody against PTGDS
| Applications | WB |
| Reactivities | Human, Primate, Mouse, Rat, Bovine, Porcine, Feline, Equine, Dog |
| Conjugation | Unconjugated |
| Immunogen | The epitope recognized by this antibody maps to region within residue 1-50 of human PTGDS. [Swiss-Prot# P41222] |
Rabbit Polyclonal SREBP1 Antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a portion of the human SREBP1 protein sequence (between residues 700-800). [Uniprot# P36956] |
Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal Antibody against VEGFA
| Applications | WB |
| Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit Polyclonal Antibody against LOX
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Cow |
| Conjugation | Unconjugated |
| Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Rabbit Polyclonal Pyruvate Carboxylase Antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | A genomic peptide made to an internal region of the human Pyruvate Carboxylase protein (within residues 930-1050). [Swiss-Prot P11498] |
Rabbit Polyclonal Perilipin Antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region between residues 450-522 (C-terminus) of the human perilipin protein. [Swiss-Prot# O60240] |
Rabbit Polyclonal LC3/MAP1LC3A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region of the human LC3 protein (within residues 50-120). [Swiss-Prot Q9H492] |
Atrial Natriuretic Factor (1-28) (hu, bo, po); neat antiserum
| Applications | ELISA |
| Reactivities | Human, Bovine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met- Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH (Disulfide bond) coupled to carrier protein. |
Endothelin-1, rabbit anti human/bovine/dog/mouse/porcine/rat, polyclonal.
| Applications | ELISA |
| Reactivities | Human, Bovine, Dog, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys- Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-OH, (Disulfide bonds between Cys1 and Cys15/Cys3 and Cys11) coupled to carrier protein. |
Rabbit polyclonal anti canine / mouse / porcine / rat Peptide YY
| Applications | ELISA |
| Reactivities | Canine, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala- Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn- Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to a carrier protein. |
Rabbit polyclonal anti ACTH (1-24) (hu, bo, rt); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Human, Bovine, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal anti ACTH (1-24) (hu, bo, rt); neat antiserum
| Applications | ELISA |
| Reactivities | Human, Bovine, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-LysPro- Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-OH (Disulfide bond) carrier protein. |
Rabbit polyclonal anti VIP (hu, ms, rt); diluted antiserum
| Applications | ELISA |
| Reactivities | Human, Bovine, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg- Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 coupled to a carrier protein. |
Rabbit polyclonal anti BNP-26 (po); neat antiserum
| Applications | ELISA |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile- Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr-OH, (Disulfide bond) coupled to a carrier protein. |
Rabbit polyclonal anti BNP-32 (po); neat antiserum
| Applications | ELISA |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ser-Pro-Lys-Thr-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly- Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val- Leu-Arg-Arg-Tyr-OH, (Disulfide bond) coupled to carrier protein. |
Rabbit polyclonal anti C-Type Natriuretic Peptide (1-29) (ms, po, rat); neat antiserum
| Applications | ELISA |
| Reactivities | Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp- Ala-Arg-Leu-Leu-His-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Gly-Asn- OH coupled to a carrier protein. |
Rabbit polyclonal anti C-Type Natriuretic Peptide (1-29) (ms, po, rt); purified rabbit IgG
| Applications | ELISA |
| Reactivities | Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp- Ala-Arg-Leu-Leu-His-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Gly-Asn- OH coupled to a carrier protein. |
Rabbit polyclonal anti human / porcine / rat C-Type Natriuretic Peptide (CNP) (32-53)
| Applications | ELISA |
| Reactivities | Human, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu- Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH (disulfide bond) coupled to carrier protein. |
Rabbit polyclonal anti C-Type Natriuretic Peptide (32-53) (hu, po, rt); neat antiserum
| Applications | ELISA |
| Reactivities | Human, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu- Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH, (Disulfide bond) coupled to carrier protein. |
Rabbit polyclonal anti VIP (hu, ms, rt); neat antiserum
| Applications | ELISA |
| Reactivities | Human, Bovine, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg- Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Glucagon (1-29) (hu, rt, po); neat antiserum
| Applications | ELISA |
| Reactivities | Human, Rat, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys- Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn- Thr-OH coupled to carrier protein. |
Rabbit polyclonal anti GRP (po); neat antiserum
| Applications | ELISA |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Ala-Pro-Val-Ser-Val-Gly-Gly-Gly-Thr-Val-Leu-Ala- Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2 coupled to carrier protein. |
Rabbit polyclonal anti PACAP-38 (16-38) (hu, ck, ms, ov, po, rt); neat antiserum
| Applications | ELISA |
| Reactivities | Human, Chicken, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg- Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys- Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 coupled to carrier protein. |
Pituitary Adenylate Cyclase-Activating Polypeptide-38 (PACAP-38), rabbit anti human/mouse/ovine/porcine/rat, polyclonal.
| Applications | ELISA |
| Reactivities | Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg- Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys- Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH₂ coupled to carrier protein. |
Rabbit polyclonal anti Endothelin-1 (hu, bo, ca, ms, po, rt); neat antiserum, Unspecific Crossreactivity Profile
| Applications | ELISA |
| Reactivities | Human, Bovine, Dog, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Cys-Ser-Cys-Ser-Ser-Leu-Met-Asp-Lys-Glu-Cys- Val-Tyr-Phe-Cys-His-Leu-Asp-Ile-Ile-Trp-OH, (Disulfide bonds between Cys1 and Cys15/Cys3 and Cys11) coupled to carrier protein. |
Rabbit polyclonal anti Secretin (po); neat antiserum
| Applications | ELISA |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg- Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2 coupled to carrier protein. |
Rabbit polyclonal anti Thr-Ala-Pro-Arg-Atrial Natriuretic Factor (1-28) (Urodilatin) (hu, bo, po); neat antiserum
| Applications | ELISA |
| Reactivities | Human, Bovine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide H-Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe- Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser- Phe-Arg-Tyr-OH, (Disulfide bond) coupled to carrier protein. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-UBB Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Hamster, Rabbit, Guinea Porcine, Bovine, Porcine, Dog, Sheep, Chicken, Xenopus, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | Native bovine Ubiquitin, conjugated to KLH |
Rabbit Polyclonal Beclin 1/ATG6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Canine, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457] |
Rabbit Polyclonal Fatty Acid Synthase/FASN Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Chicken, Hamster, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide, conjugated to KLH, made near the N-terminus of mouse FAS. [Swiss-Prot# P19096] |
Active filters
Reactivities
- Porcine
Antibody Hosts
- Rabbit
Filter by
Category
Target Symbol
- EDN1 (8)
- ADCYAP1 (7)
- NPPB (6)
- NPPA (5)
- NPPC (5)
- VIP (5)
- CANX (4)
- GRP (4)
- CHGA (3)
- GAL (3)
- GCG (3)
- HRCT (3)
- KCNA2 (3)
- NPY (3)
- POMC (3)
- PYY (3)
- SCT (3)
- HIF1A (2)
- INHA (2)
- LOX (2)
- UCHL1 (2)
- ACAN (1)
- ACAT1 (1)
- ACAT2 (1)
- ACTB (1)
- AQP2 (1)
- ATG5 (1)
- BCL2L1 (1)
- BECN1 (1)
- CALR (1)
- CUEDC2 (1)
- DUOX2 (1)
- EGR2 (1)
- FASN (1)
- FLI1 (1)
- GAPDH (1)
- GIP (1)
- GKN1 (1)
- GNAS (1)
- GPAT4 (1)
- HEMOPRESSIN (1)
- HSPA1A (1)
- IFRD1 (1)
- INS (1)
- LGR5 (1)
- LRRK2 (1)
- MAP1LC3B (1)
- MKI67 (1)
- MUC1 (1)
- NEFH (1)
- NEFL (1)
- NEFM (1)
- NPC1 (1)
- PC (1)
- PIK3C3 (1)
- PLIN1 (1)
- PLIN2 (1)
- PLIN3 (1)
- PLK1 (1)
- PTGDS (1)
- SAT1 (1)
- SLC31A1 (1)
- SOX2 (1)
- SREBF1 (1)
- SYCP3 (1)
- TLR5 (1)
- TUBB (1)
- UBB (1)
- VEGFA (1)
Isotypes
Clonalities
Conjugates
Assay Types
Families
Pathways
- Metabolic pathways (9)
- Antigen processing and presentation (6)
- Amyotrophic lateral sclerosis (ALS) (4)
- Parkinson's disease (4)
- Pathways in cancer (4)
- Regulation of autophagy (4)
- mTOR signaling pathway (4)
- Insulin signaling pathway (3)
- Pathogenic Escherichia coli infection (3)
- Pyruvate metabolism (3)
- Renal cell carcinoma (3)
- Butanoate metabolism (2)
- Dilated cardiomyopathy (2)
- Fatty acid metabolism (2)
- Focal adhesion (2)
- Gap junction (2)
- Lysine degradation (2)
- Oocyte meiosis (2)
- Pancreatic cancer (2)
- Progesterone-mediated oocyte maturation (2)
- Propanoate metabolism (2)
- Regulation of actin cytoskeleton (2)
- Synthesis and degradation of ketone bodies (2)
- Terpenoid backbone biosynthesis (2)
- Tryptophan metabolism (2)
- Valine (2)
- Vibrio cholerae infection (2)
- leucine and isoleucine degradation (2)
- Adherens junction (1)
- Alzheimer's disease (1)
- Apoptosis (1)
- Arachidonic acid metabolism (1)
- Arginine and proline metabolism (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- Bladder cancer (1)
- Calcium signaling pathway (1)
- Cell cycle (1)
- Chronic myeloid leukemia (1)
- Citrate cycle (TCA cycle) (1)
- Cytokine-cytokine receptor interaction (1)
- Endocytosis (1)
- Ether lipid metabolism (1)
- Fatty acid biosynthesis (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- Glycolysis / Gluconeogenesis (1)
- GnRH signaling pathway (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Inositol phosphate metabolism (1)
- Jak-STAT signaling pathway (1)
- Leukocyte transendothelial migration (1)
- Long-term depression (1)
- Lysosome (1)
- MAPK signaling pathway (1)
- Maturity onset diabetes of the young (1)
- Melanogenesis (1)
- PPAR signaling pathway (1)
- Phosphatidylinositol signaling system (1)
- Prion diseases (1)
- Prostate cancer (1)
- RIG-I-like receptor signaling pathway (1)
- Small cell lung cancer (1)
- Spliceosome (1)
- Taste transduction (1)
- Tight junction (1)
- Toll-like receptor signaling pathway (1)
- Type I diabetes mellitus (1)
- Type II diabetes mellitus (1)
- VEGF signaling pathway (1)
- Vascular smooth muscle contraction (1)
- Viral myocarditis (1)