Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-BUB3 Antibody - N-terminal region
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BUB3 antibody: synthetic peptide directed towards the N terminal of human BUB3. Synthetic peptide located within the following region: MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit Polyclonal antibody to Mad2L1 (MAD2 mitotic arrest deficient-like 1 (yeast))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 142 and 205 of MAD2L1 (Uniprot ID#Q13257) |
Rabbit polyclonal SMAD3-S208 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit polyclonal HDAC2 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HDAC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 410-439 amino acids from the Central region of human HDAC2. |
Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | Assay, FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit polyclonal 14-3-3 zeta/delta (Ab-232) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human 14-3-3 ?/d around the phosphorylation site of threonine 232 (S-D-TP-Q-G) |
Rabbit polyclonal Cyclin E1 (Ab-395) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-T-P-P). |
Rabbit polyclonal Cyclin B1 (Ab-126) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin B1 around the phosphorylation site of serine 126 (T-A-S-P-S). |
Rabbit polyclonal Cyclin H (Ab-315) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin H around the phosphorylation site of threonine 315 (E-W-TP-D-D). |
Rabbit polyclonal 14-3-3 zeta (Ser58) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human 14-3-3 ? around the phosphorylation site of serine 58 (R-S-SP-W-R) |
| Modifications | Phospho-specific |
Rabbit polyclonal SMAD4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SMAD4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 400-428 amino acids from the C-terminal region of human SMAD4. |
Mouse Monoclonal E2F-1 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal DNA-PKcs Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to 14-3-3 beta (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 171 of 14-3-3 beta (Uniprot ID#P31946) |
Rabbit polyclonal Chk2 (Thr383) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Chk2 around the phosphorylation site of threonine 383 (M-R-TP-L-C). |
| Modifications | Phospho-specific |
Active filters
Category
- Antibodies
Applications
- IF
Conjugates
- Unconjugated
Pathways
- Cell cycle
Filter by
Target Symbol
- TP53 (66)
- CDKN2A (52)
- BUB1B (34)
- CDK2 (32)
- GADD45G (20)
- ANAPC2 (18)
- HDAC1 (18)
- MYC (17)
- ANAPC11 (16)
- CHEK2 (11)
- SMAD2 (10)
- PKMYT1 (9)
- TGFB1 (6)
- MAD2L1 (5)
- CDKN2B (4)
- HDAC2 (4)
- PCNA (4)
- PRKDC (4)
- PLK1 (3)
- YWHAG (3)
- YWHAZ (3)
- ABL1 (2)
- ANAPC5 (2)
- ATM (2)
- BUB3 (2)
- CCNB1 (2)
- CCNE1 (2)
- CDC16 (2)
- CDC2 (2)
- CDKN1C (2)
- CUL1 (2)
- E2F1 (2)
- GSK3B (2)
- MCM5 (2)
- MDM2 (2)
- SMAD3 (2)
- SMAD4 (2)
- TFDP1 (2)
- ANAPC1 (1)
- ANAPC10 (1)
- ANAPC13 (1)
- ANAPC7 (1)
- BUB1 (1)
- CCNA1 (1)
- CCNH (1)
- CDC23 (1)
- CDC25C (1)
- CDC26 (1)
- CDC45 (1)
- CDK1 (1)
- CDK4 (1)
- CDK6 (1)
- CHEK1 (1)
- CREBBP (1)
- E2F3 (1)
- ESPL1 (1)
- MCM3 (1)
- MCM7 (1)
- PTTG1 (1)
- PTTG2 (1)
- RB1 (1)
- SMC1A (1)
- SMC1B (1)
- YWHAB (1)
- YWHAH (1)
Reactivities
Antibody Hosts
Clonalities
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (371)
- Stem cell - Pluripotency (168)
- Transcription Factors (146)
- Protein Kinase (106)
- Embryonic stem cells (29)
- Stem cell relevant signaling - JAK/STAT signaling pathway (29)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (29)
- Stem cell relevant signaling - DSL/Notch pathway (20)
- Adult stem cells (18)
- ES Cell Differentiation/IPS (18)
- Induced pluripotent stem cells (17)
- Stem cell relevant signaling - Wnt Signaling pathway (17)
- Cancer stem cells (12)
- Secreted Protein (6)
- Phosphatase (1)
- Protease (1)