Germany
Japan
United Kingdom
China
Antibodies
Rabbit Polyclonal Anti-MFN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MFN2 antibody was raised against a 17 amino acid peptide near the center of human MFN2. The immunogen is located within amino acids 250 - 300 of MFN2. |
Rabbit Polyclonal Anti-HNRPL Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPL antibody: synthetic peptide directed towards the N terminal of human HNRPL. Synthetic peptide located within the following region: AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV |
Rabbit Polyclonal H3K18ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse, Broad |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K18ac antibody: the region of histone H3 containing the acetylated lysine 18 (H3K18ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3R17me2(asym)K18ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse, Broad |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3R17me2(asym)K18ac antibody: the region of histone H3 containing the asymmetrically dimethylated R17 and the acetylated lysine 18 (H3R17me2(asym)K18ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H4K5,8,12ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse, Broad |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H4K5,8,12ac antibody: the region of histone H4 containing the acetylated lysines 5, 8 and 12 (H4K5,8,12ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus. |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal ASAH1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | ASAH1 antibody was raised against a 16 amino acid synthetic peptide near the carboxy terminus of the human ASAH1. The immunogen is located within amino acids 240 - 290 of ASAH1. |
Rabbit Polyclonal Betatrophin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Betatrophin antibody was raised against a 16 amino acid peptide near the amino terminus of human Betatrophin. The immunogen is located within amino acids 40 - 90 of Betatrophin. |
NOS1 (134-148) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Rabbit Polyclonal H4K5,8,12,16ac Antibody
| Applications | Dot, ELISA, IF |
| Reactivities | Human, Mouse, Broad |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H4K5,8,12,16ac antibody: the region of histone H4 containing the acetylated lysines 5, 8, 12 and 16 (H4K5,8,12,16ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 17 amino acid peptide near the amino terminus of human PPARGC1A. The immunogen is located within amino acids 200 - 250 of PPARGC1A. |
Rabbit Polyclonal antibody to LDB1 (LIM domain binding 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 86 and 411 of LDB1 (Uniprot ID#Q86U70) |
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
XRCC2 Rabbit Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human XRCC2 |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Active filters
Filter by
Target Symbol
- MAP2K1 (205)
- MAP2K3 (133)
- ERCC1 (97)
- MAPK13 (86)
- L1CAM (82)
- PNMT (80)
- ERBB2 (78)
- VIM (78)
- APP (64)
- SQSTM1 (64)
- LOX (63)
- PTPRE (60)
- AKT1 (57)
- ACAT2 (56)
- CTNNB1 (56)
- MIOX (56)
- NPR3 (56)
- PSMC3 (56)
- MAPK7 (55)
- MOB3B (55)
- SENP2 (55)
- IGF2BP2 (54)
- GFAP (53)
- CDK2 (52)
- SYP (52)
- UBE2G2 (52)
- BTK (50)
- LIMK1 (50)
- PIK3AP1 (50)
- RNF144B (50)
- SMS (50)
- SPG7 (50)
- BECN1 (49)
- SNAP25 (48)
- PGAM2 (47)
- SOCS3 (47)
- ERG (46)
- SNX9 (46)
- ARHGAP25 (45)
- CCM2 (45)
- ELK3 (45)
- FOXI1 (45)
- HOXC11 (45)
- PARVA (45)
- PIK3R5 (45)
- TAL1 (45)
- ALDH1L1 (44)
- ERCC4 (44)
- POR (43)
- PRKAR2A (42)
- ACAA2 (41)
- PYCR2 (41)
- RASSF1 (41)
- ARFGAP1 (40)
- CRYAB (40)
- DYNC1LI1 (40)
- MMP13 (40)
- PRKCE (40)
- RALBP1 (40)
- RFXANK (40)
- TH (40)
- TOMM34 (40)
- TTLL12 (40)
- ZFAND2B (40)
- UNG (39)
- ATG3 (38)
- STAT5A (38)
- TLE1 (38)
- HRAS (37)
- AK4 (36)
- FBXO21 (36)
- LDLRAP1 (36)
- NKX2-1 (36)
- PDCD1 (36)
- PPARA (36)
- PPP5C (36)
- PRMT2 (36)
- EFNA2 (35)
- GATA3 (35)
- HID1 (35)
- ID3 (35)
- KATNB1 (35)
- KCNJ3 (35)
- LHX1 (35)
- PSMD2 (35)
- RAB30 (35)
- RPN1 (35)
- SIRT5 (35)
- SNX8 (35)
- TMOD1 (35)
- ZFP36 (35)
- BRAF (33)
- LGR5 (33)
- GADD45G (32)
- PFKP (32)
- SATB1 (32)
- STAT4 (32)
- AK5 (31)
- CMPK1 (31)
- DLD (31)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (2351)
- Phospho-specific (108)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (7)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (6)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (4)
- Acetyl K5 (3)
- This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (3)
- Acetyl K12 (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human scFv format, for improved compatibility with existing reagents, assays and techniques. (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K16 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K27 (1)
- Acetyl K29 (1)
- Acetyl K36 (1)
- Acetyl K4 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S2056 (1)
- Phospho S241 (1)
- Phospho S2448 (1)
- Phospho S28 (1)
- Phospho S428 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S519/T522 (1)
- Phospho S9 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho T11 (1)
- Phospho T180/Y182 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T389 (1)
- Phospho T395 (1)
- Phospho T45 (1)
- Phospho T498 (1)
- Phospho T6 (1)
- Phospho T91 (1)
- Phospho Y1022/1023 (1)
- Phospho Y15 (1)
- Phospho Y705 (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Armenian Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This constant region of this antibody has been modified to bind to Protein A, allowing highly-specific purification of this antibody by Protein A-affinity column. (1)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- This full-length, reformatted mouse antibody was made using the variable domain sequences of the original Mouse scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted rat antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted rat antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- Unconjugated (1)
- citrulline R2/R8/R17 (1)
Assay Types
Families
- Druggable Genome (8166)
- Transcription Factors (2030)
- Transmembrane (1978)
- Protein Kinase (1562)
- ES Cell Differentiation/IPS (1040)
- Secreted Protein (600)
- Stem cell - Pluripotency (524)
- Protease (496)
- Adult stem cells (206)
- Phosphatase (179)
- GPCR (141)
- Stem cell relevant signaling - JAK/STAT signaling pathway (126)
- Embryonic stem cells (104)
- Stem cell relevant signaling - DSL/Notch pathway (95)
- Cancer stem cells (85)
- Induced pluripotent stem cells (71)
- Nuclear Hormone Receptor (68)
- Ion Channels: Other (66)
- P450 (65)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (55)
- Ion Channels: Potassium (42)
- Stem cell relevant signaling - Wnt Signaling pathway (22)
- Ion Channels: Transient receptor potential (16)
- Ion Channels: Glutamate Receptors (9)
- Ion Channels: Cyclic nucleotide gated (4)
- Ion Channels: Cys-loop Receptors (3)
- Ion Channels: ATP Receptors (2)
- Ion Channels: Calcium (2)
Pathways
- Metabolic pathways (1403)
- Pathways in cancer (1307)
- MAPK signaling pathway (1087)
- Focal adhesion (879)
- Neurotrophin signaling pathway (806)
- Fc epsilon RI signaling pathway (789)
- Prostate cancer (789)
- Insulin signaling pathway (749)
- ErbB signaling pathway (744)
- Progesterone-mediated oocyte maturation (738)
- Toll-like receptor signaling pathway (737)
- Regulation of actin cytoskeleton (674)
- GnRH signaling pathway (671)
- Pancreatic cancer (669)
- Endometrial cancer (668)
- Colorectal cancer (660)
- Chronic myeloid leukemia (636)
- Non-small cell lung cancer (633)
- T cell receptor signaling pathway (623)
- Acute myeloid leukemia (584)
- B cell receptor signaling pathway (573)
- Glioma (564)
- Renal cell carcinoma (563)
- Chemokine signaling pathway (562)
- Melanoma (558)
- VEGF signaling pathway (548)
- Bladder cancer (533)
- Fc gamma R-mediated phagocytosis (530)
- Gap junction (523)
- Natural killer cell mediated cytotoxicity (436)
- Oocyte meiosis (412)
- Thyroid cancer (409)
- Leukocyte transendothelial migration (375)
- Melanogenesis (363)
- Vascular smooth muscle contraction (344)
- Cell cycle (340)
- Endocytosis (333)
- Long-term potentiation (326)
- Long-term depression (324)
- Small cell lung cancer (317)
- Jak-STAT signaling pathway (314)
- Amyotrophic lateral sclerosis (ALS) (313)
- Axon guidance (310)
- Apoptosis (308)
- Wnt signaling pathway (295)
- Ubiquitin mediated proteolysis (294)
- Adherens junction (292)
- Prion diseases (287)
- Purine metabolism (278)
- Tight junction (274)
- Type II diabetes mellitus (271)
- mTOR signaling pathway (264)
- Dorso-ventral axis formation (255)
- Alzheimer's disease (243)
- Epithelial cell signaling in Helicobacter pylori infection (237)
- Pathogenic Escherichia coli infection (231)
- Adipocytokine signaling pathway (227)
- Glycolysis / Gluconeogenesis (226)
- Nucleotide excision repair (195)
- Huntington's disease (193)
- Calcium signaling pathway (192)
- p53 signaling pathway (189)
- Valine (188)
- NOD-like receptor signaling pathway (187)
- Parkinson's disease (173)
- leucine and isoleucine degradation (173)
- RIG-I-like receptor signaling pathway (172)
- TGF-beta signaling pathway (172)
- Cell adhesion molecules (CAMs) (169)
- Primary immunodeficiency (140)
- Basal cell carcinoma (139)
- Pyruvate metabolism (138)
- Tyrosine metabolism (138)
- Proteasome (137)
- Cytokine-cytokine receptor interaction (136)
- Pyrimidine metabolism (134)
- Arginine and proline metabolism (131)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (127)
- Antigen processing and presentation (118)
- Butanoate metabolism (117)
- Citrate cycle (TCA cycle) (113)
- Fatty acid metabolism (110)
- Neuroactive ligand-receptor interaction (110)
- Inositol phosphate metabolism (109)
- Regulation of autophagy (108)
- Phosphatidylinositol signaling system (101)
- Maturity onset diabetes of the young (98)
- Lysine degradation (93)
- Vibrio cholerae infection (90)
- Base excision repair (88)
- Glycine (85)
- serine and threonine metabolism (85)
- Glutathione metabolism (84)
- Oxidative phosphorylation (83)
- Notch signaling pathway (81)
- Tryptophan metabolism (80)
- beta-Alanine metabolism (78)
- Propanoate metabolism (77)
- PPAR signaling pathway (75)
- RNA degradation (75)
- Dilated cardiomyopathy (72)
- Hypertrophic cardiomyopathy (HCM) (72)
- Synthesis and degradation of ketone bodies (71)
- Terpenoid backbone biosynthesis (71)
- Amino sugar and nucleotide sugar metabolism (70)
- Pentose phosphate pathway (70)
- Cysteine and methionine metabolism (67)
- Hedgehog signaling pathway (64)
- Ascorbate and aldarate metabolism (61)
- Spliceosome (61)
- DNA replication (57)
- Mismatch repair (55)
- Cytosolic DNA-sensing pathway (52)
- One carbon pool by folate (52)
- SNARE interactions in vesicular transport (52)
- Starch and sucrose metabolism (51)
- Viral myocarditis (51)
- Galactose metabolism (47)
- Lysosome (46)
- Systemic lupus erythematosus (45)
- Fructose and mannose metabolism (44)
- Homologous recombination (43)
- Drug metabolism - other enzymes (41)
- Glycerolipid metabolism (41)
- Fatty acid elongation in mitochondria (40)
- N-Glycan biosynthesis (39)
- Alanine (36)
- aspartate and glutamate metabolism (36)
- RNA polymerase (35)
- Porphyrin and chlorophyll metabolism (32)
- Retinol metabolism (30)
- Arachidonic acid metabolism (28)
- Glyoxylate and dicarboxylate metabolism (27)
- Histidine metabolism (26)
- Drug metabolism - cytochrome P450 (25)
- Cardiac muscle contraction (24)
- Type I diabetes mellitus (24)
- Circadian rhythm - mammal (22)
- Glycosaminoglycan degradation (22)
- Pantothenate and CoA biosynthesis (22)
- Hematopoietic cell lineage (21)
- ECM-receptor interaction (19)
- Basal transcription factors (18)
- Androgen and estrogen metabolism (17)
- Glycosphingolipid biosynthesis - lacto and neolacto series (17)
- Methane metabolism (17)
- Selenoamino acid metabolism (17)
- Caffeine metabolism (16)
- Nicotinate and nicotinamide metabolism (16)
- Olfactory transduction (16)
- Vitamin B6 metabolism (16)
- Complement and coagulation cascades (15)
- Keratan sulfate biosynthesis (15)
- Primary bile acid biosynthesis (15)
- Renin-angiotensin system (15)
- Ribosome (15)
- leucine and isoleucine biosynthesis (15)
- Nitrogen metabolism (14)
- Taurine and hypotaurine metabolism (13)
- Metabolism of xenobiotics by cytochrome P450 (11)
- Sphingolipid metabolism (11)
- Steroid biosynthesis (10)
- Non-homologous end-joining (8)
- Other glycan degradation (8)
- Folate biosynthesis (7)
- Glycerophospholipid metabolism (6)
- Limonene and pinene degradation (6)
- ABC transporters (5)
- Fatty acid biosynthesis (5)
- Glycosphingolipid biosynthesis - ganglio series (5)
- Heparan sulfate biosynthesis (5)
- O-Glycan biosynthesis (5)
- Taste transduction (5)
- Allograft rejection (3)
- Aminoacyl-tRNA biosynthesis (3)
- Chondroitin sulfate biosynthesis (3)
- D-Glutamine and D-glutamate metabolism (3)
- Graft-versus-host disease (3)
- Asthma (2)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)
- Linoleic acid metabolism (2)
- Phenylalanine metabolism (2)
- Autoimmune thyroid disease (1)
- Biosynthesis of unsaturated fatty acids (1)
- Ether lipid metabolism (1)
- Riboflavin metabolism (1)
- Sulfur metabolism (1)