Rabbit polyclonal Collagen II antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Collagen II. |
Rabbit polyclonal Collagen II antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Collagen II. |
Rabbit polyclonal Syndecan4 (Ab-179) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Rabbit polyclonal anti-LAMA1 antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMA1. |
Rabbit Polyclonal RHAMM Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | RHAMM antibody was raised against a 18 amino acid synthetic peptide near the amino terminus of human RHAMM. |
Rabbit Polyclonal Integrin alpha 4 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Integrin alpha 4 antibody was raised against a 15 amino acid peptide from near the center of human Integrin alpha 4. |
Rabbit Polyclonal SPP1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SPP1 antibody was raised against an 18 amino acid peptide near the amino terminus of human SPP1. |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Rabbit Polyclonal Antibody against CD36
Applications | IHC, WB |
Reactivities | Human, Bovine, Monkey |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide mapping to a region of human CD36 between residues 100-200. |
Collagen IV (COL4A1) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Bovine, Human |
Immunogen | Collagen Type IV from Human and Bovine placenta. |
Rabbit polyclonal Collagen I a2 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Collagen I a2. |
Rabbit polyclonal Collagen VI a3 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Collagen VI a3. |
Rabbit polyclonal anti-LAMB1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human LAMB1. |
COL5A2 (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated from the N-term (1-50) |
Rabbit Polyclonal antibody to Collagen III alpha1 (collagen, type III, alpha 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1247 and 1389 of Collagen III alpha1 |
Rabbit polyclonal anti-LAMA4 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMA4. |
Collagen I (COL1A1) (+ type III) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC |
Reactivities | Human, Porcine |
Immunogen | Porcine Collagen, types 1 and 3 from skin |
Integrin alpha 4 (ITGA4) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to the C-terminal of human ITGA4 |
Rabbit polyclonal antibody to Collagen I alpha2 (collagen, type I, alpha 2)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1057 and 1366 of Collagen I alpha2 (Uniprot ID#P08123) |
Rabbit polyclonal Collagen III antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human collagen III. |
Rabbit polyclonal anti-LAMB3 antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMB3. |
Rabbit polyclonal Collagen IV a4 antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Collagen IV a4. |
Rabbit polyclonal Collagen V a1 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Collagen V a1. |
Rabbit polyclonal anti-LAMC3 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMC3. |
Rabbit polyclonal Collagen V a3 antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Collagen V a3. |
Rabbit polyclonal anti-OR10J6 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human OR10J6. |
Goat Anti-THBS1 Antibody
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence NRIPESGGDNSVFD-C, from the N Terminus of the protein sequence according to NP_003237.2. |
CDX2 rabbit monoclonal antibody, clone EPR2764Y, Supernatant
Applications | IF, IHC, WB |
Reactivities | Human |
Collagen I (COL1A1) rabbit polyclonal antibody, Azide Free
Applications | ELISA, IF, IHC |
Reactivities | Human |
Immunogen | Collagen I antibody was raised against human placental collagen Type I. |
Rabbit Polyclonal GPVI Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GPVI antibody was raised against a 15 amino acid peptide near the carboxy terminus of the human GPVI. |
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Rabbit polyclonal anti-LAMA2 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMA2. |
Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6. |
Rabbit Polyclonal Anti-ITGA2 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF |
Von Willebrand Factor (VWF) sheep polyclonal antibody, FITC
Applications | IF, IHC |
Reactivities | Human |
Conjugation | FITC |
Immunogen | Human von Willebrand Factor Antigen (vWF) prepared from citrated Human plasma (>95%). |
Rabbit Polyclonal Integrin alpha 4 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Integrin alpha 4 antibody was raised against a 16 amino acid peptide from near the center of human Integrin alpha 4. |
Rabbit polyclonal Collagen IV a6 antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Collagen IV a6. |
Rabbit polyclonal Collagen V a2 antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Collagen V a2. |
Rabbit Polyclonal Anti-Chondroadherin Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Chondroadherin antibody was raised against a 17 amino acid peptide near the carboxy terminus of human Chondroadherin. The immunogen is located within the last 50 amino acids of Chondroadherin. |