Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 428.00
In Stock
USD 428.00
In Stock
Rabbit Polyclonal Anti-E2F6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human E2F6 |
TA349302 is a possible alternative to TA324290.
Rabbit Polyclonal Anti-PHB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHB |
TA349430 is a possible alternative to TA322982.
Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the C terminal of human HNRPD. Synthetic peptide located within the following region: YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal GR (Ab-211) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W). |
Rabbit polyclonal MITF (Ab-180/73) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MITF around the phosphorylation site of serine 180/73 (P-N-SP-P-M). |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Isotypes
- IgG
Families
- Transcription Factors
Availabilities
- In Stock
Filter by
Target Symbol
- ESR1 (6)
- ATF2 (5)
- JUN (5)
- NR3C1 (5)
- CCNE1 (4)
- HDAC1 (4)
- HDAC2 (4)
- JUND (4)
- KAT5 (4)
- NFKB2 (4)
- RAB25 (4)
- STAT3 (4)
- STAT5B (4)
- WT1 (4)
- XRCC6 (4)
- AHR (3)
- ATF4 (3)
- BRCA1 (3)
- CREB1 (3)
- DNMT1 (3)
- FOS (3)
- HMGN5 (3)
- HNF1B (3)
- HNRNPD (3)
- HSF1 (3)
- LIN28A (3)
- MCM7 (3)
- PTMA (3)
- RAN (3)
- RELA (3)
- SMAD1 (3)
- SREBF2 (3)
- SRF (3)
- SSB (3)
- STAT1 (3)
- TP73 (3)
- TRIM32 (3)
- ACAD8 (2)
- APEX1 (2)
- AR (2)
- CBX8 (2)
- CCNC (2)
- CEBPG (2)
- CNNM3 (2)
- CTNNB1 (2)
- DLX3 (2)
- DTX1 (2)
- E2F6 (2)
- ELK1 (2)
- ENO1 (2)
- EP300 (2)
- FOXD2 (2)
- FOXO1 (2)
- FOXO3 (2)
- FOXR2 (2)
- GATA3 (2)
- GATA6 (2)
- HDAC4 (2)
- HMGA1 (2)
- HMGB1 (2)
- HOXB1 (2)
- ID2 (2)
- ID4 (2)
- IKBKG (2)
- IRF3 (2)
- JUNB (2)
- KDM4A (2)
- KEAP1 (2)
- MAFF (2)
- MCM2 (2)
- MCM3 (2)
- MCM5 (2)
- MCM6 (2)
- MDM2 (2)
- MED15 (2)
- MEF2C (2)
- MYB (2)
- NFATC4 (2)
- NFKB1 (2)
- NFKBIE (2)
- NRG1 (2)
- OLIG2 (2)
- PARD6A (2)
- PAWR (2)
- PAX5 (2)
- PAX8 (2)
- PDX1 (2)
- PIAS1 (2)
- PIAS3 (2)
- POFUT1 (2)
- POU2F1 (2)
- POU5F1 (2)
- PRDX3 (2)
- PRKCQ (2)
- PTTG1 (2)
- RAB8A (2)
- RARA (2)
- REL (2)
- RPS6KA5 (2)
- SF1 (2)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (88)
- MAPK signaling pathway (56)
- Cell cycle (42)
- Prostate cancer (34)
- Chronic myeloid leukemia (32)
- Wnt signaling pathway (28)
- Neurotrophin signaling pathway (27)
- T cell receptor signaling pathway (27)
- Toll-like receptor signaling pathway (26)
- Acute myeloid leukemia (25)
- Small cell lung cancer (24)
- TGF-beta signaling pathway (24)
- B cell receptor signaling pathway (23)
- Chemokine signaling pathway (23)
- Jak-STAT signaling pathway (23)
- Adipocytokine signaling pathway (21)
- Huntington's disease (21)
- Pancreatic cancer (21)
- Ubiquitin mediated proteolysis (20)
- ErbB signaling pathway (17)
- Colorectal cancer (15)
- RIG-I-like receptor signaling pathway (14)
- Apoptosis (13)
- Epithelial cell signaling in Helicobacter pylori infection (13)
- p53 signaling pathway (13)
- DNA replication (12)
- Metabolic pathways (12)
- Notch signaling pathway (12)
- Renal cell carcinoma (12)
- Cytosolic DNA-sensing pathway (11)
- GnRH signaling pathway (11)
- Endocytosis (10)
- Endometrial cancer (10)
- Focal adhesion (10)
- NOD-like receptor signaling pathway (10)
- Thyroid cancer (10)
- Basal transcription factors (9)
- Bladder cancer (9)
- Melanogenesis (9)
- Oocyte meiosis (9)
- Non-small cell lung cancer (8)
- Adherens junction (7)
- Amyotrophic lateral sclerosis (ALS) (7)
- Basal cell carcinoma (7)
- Maturity onset diabetes of the young (7)
- Melanoma (7)
- Natural killer cell mediated cytotoxicity (7)
- Tight junction (7)
- Axon guidance (6)
- Glioma (6)
- Insulin signaling pathway (6)
- Neuroactive ligand-receptor interaction (6)
- Systemic lupus erythematosus (6)
- Antigen processing and presentation (5)
- Base excision repair (5)
- Long-term potentiation (5)
- Type II diabetes mellitus (5)
- VEGF signaling pathway (5)
- Allograft rejection (4)
- Alzheimer's disease (4)
- Cysteine and methionine metabolism (4)
- Cytokine-cytokine receptor interaction (4)
- Graft-versus-host disease (4)
- Non-homologous end-joining (4)
- PPAR signaling pathway (4)
- Type I diabetes mellitus (4)
- Viral myocarditis (4)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- Fc epsilon RI signaling pathway (3)
- Pathogenic Escherichia coli infection (3)
- RNA degradation (3)
- Asthma (2)
- Autoimmune thyroid disease (2)
- Cell adhesion molecules (CAMs) (2)
- Dilated cardiomyopathy (2)
- Fc gamma R-mediated phagocytosis (2)
- Glycolysis / Gluconeogenesis (2)
- Hedgehog signaling pathway (2)
- Hematopoietic cell lineage (2)
- Hypertrophic cardiomyopathy (HCM) (2)
- Leukocyte transendothelial migration (2)
- Nucleotide excision repair (2)
- Primary immunodeficiency (2)
- Prion diseases (2)
- Valine (2)
- Vascular smooth muscle contraction (2)
- leucine and isoleucine degradation (2)
- Biosynthesis of unsaturated fatty acids (1)
- Calcium signaling pathway (1)
- Circadian rhythm - mammal (1)
- Dorso-ventral axis formation (1)
- Glycerolipid metabolism (1)
- Glycine (1)
- Glyoxylate and dicarboxylate metabolism (1)
- Homologous recombination (1)
- Long-term depression (1)
- Purine metabolism (1)
- Pyrimidine metabolism (1)
- Regulation of actin cytoskeleton (1)
- Ribosome (1)
- Spliceosome (1)
- mTOR signaling pathway (1)
- serine and threonine metabolism (1)