Rabbit Polyclonal VGF Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VGF antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of the human VGF. The immunogen is located within the last 50 amino acids of VGF. |
Chicken Polyclonal Albumin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Albumin antibody was raised against a 13 amino acid synthetic peptide near the center of human Albumin. The immunogen is located within amino acids 340 - 390 of Albumin. |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Rabbit Polyclonal Anti-MFAP4 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MFAP4 antibody: synthetic peptide directed towards the N terminal of human MFAP4. Synthetic peptide located within the following region: TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK |
Rabbit anti-CFB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CFB |
Rabbit anti-PRG2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRG2 |
TGFBI Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | TGFBI antibody was raised against synthetic peptide C-QLYTDRTEKLRPE from an internal region of human TGFBI (NP_000349.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum (100%); Marmoset, Platypus (92%). |
Rabbit polyclonal HtrA1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This HtrA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 116-147 amino acids from the N-terminal region of human HtrA1. |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit polyclonal WNT5B Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This WNT5B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-182 amino acids from the Central region of human WNT5B. |
Rabbit anti-EPO Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human EPO |
Rabbit anti-TFRC Polyclonal Antibody
| Applications | ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TFRC |
Rabbit polyclonal Anti-Sema3f Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Sema3f antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FIHAELIPDSAERNDDKLYFFFRERSAEAPQNPAVYARIGRICLNDDGGH |
Rabbit Polyclonal CTRP3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CTRP3 antibody was raised against a 16 amino acid synthetic peptide from near the center of human CTRP3. The immunogen is located within amino acids 90 - 140 of CTRP3. |
Rabbit Polyclonal NPTX2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | NPTX2 antibody was raised against a 16 amino acid synthetic peptide near the center of the human NPTX2. The immunogen is located within amino acids 170 - 220 of NPTX2. |
Rabbit polyclonal PCSK2 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This PCSK2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 87-116 amino acids from the N-terminal region of human PCSK2. |
Rabbit anti-IGF2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IGF2 |
Rabbit anti-TNFSF13B Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human TNFSF13B |
Germany
Japan
United Kingdom
China
