Germany
Japan
United Kingdom
China
Antibodies
ALK mouse monoclonal antibody, clone OTI1A4
| Applications | IHC, LMNX, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
.jpg?d=110x100 "User supplied image")
Goat Anti-Rabbit IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Rabbit IgG |
| Conjugation | Unconjugated |
| Immunogen | Rabbit IgG, whole molecule |
Goat Anti-Mouse IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Mouse IgG |
| Conjugation | Unconjugated |
| Immunogen | Mouse IgG, whole molecule |
Tyrosine Hydroxylase (TH) mouse monoclonal antibody, clone LNC1
| Applications | IF, IHC, WB |
| Reactivities | All Species |
| Conjugation | Unconjugated |
VIP rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Porcine VIP coupled to bovine thyroglobulin (BTg) with carbodiimide (CDI) linker. |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Antibody against GFAP (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GFAP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human GFAP. |
Rabbit Anti-Mouse IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Mouse IgG |
| Conjugation | Unconjugated |
| Immunogen | Mouse IgG, whole molecule |
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Active filters
Category
Applications
- IHC
Conjugates
- Unconjugated
Filter by
Target Symbol
- MAP2K1 (111)
- TP53 (106)
- MKI67 (93)
- KRT19 (86)
- NME1 (86)
- ERBB2 (79)
- MSMB (79)
- PECAM1 (78)
- TG (74)
- OTC (73)
- KLK8 (72)
- NBN (72)
- LIPG (71)
- PGR (71)
- AKT1 (63)
- CD4 (61)
- CTAG1B (61)
- MAP2K3 (61)
- CDKN2A (60)
- ABCB1 (55)
- JUN (55)
- CD99 (54)
- PTPRC (54)
- EPCAM (53)
- LGALS3 (53)
- CHGA (52)
- CTNNB1 (52)
- ADIPOQ (51)
- APP (51)
- PCNA (51)
- BCL2 (49)
- ERCC1 (48)
- CD44 (47)
- NKX3-1 (46)
- VSNL1 (46)
- EGFR (45)
- TOP2A (45)
- KRT20 (44)
- NCAM1 (44)
- PDCD1 (44)
- PIK3C2A (44)
- MLANA (43)
- MS4A1 (43)
- CD68 (41)
- MUC1 (41)
- SENP2 (40)
- AGR2 (39)
- ESR1 (39)
- MEF2C (39)
- CDH1 (38)
- KIT (38)
- S100A9 (38)
- ABAT (37)
- BSG (37)
- KRT18 (37)
- LOX (37)
- SYP (37)
- BBOX1 (36)
- PIK3CG (36)
- RTRAF (36)
- SQSTM1 (36)
- TYMP (36)
- BTK (35)
- KRT7 (35)
- MCM2 (35)
- AMACR (34)
- CD40 (34)
- F13A1 (34)
- HSPD1 (34)
- MDM4 (34)
- MGLL (34)
- MGMT (34)
- POR (34)
- PROCR (34)
- BUB1B (33)
- CD163 (33)
- NAPSA (33)
- NR3C1 (33)
- PFKP (33)
- TNFRSF8 (33)
- TYMS (33)
- VBP1 (33)
- AKR1A1 (32)
- CD63 (32)
- CTSL (32)
- GFAP (32)
- LPIN1 (32)
- LTA4H (32)
- MTOR (32)
- NPR3 (32)
- PDE4A (32)
- PPP5C (32)
- UBE2G2 (32)
- VIM (32)
- VWF (32)
- CR2 (31)
- MYC (31)
- RET (31)
- SERPINB3 (31)
- ALDH1L1 (30)
Reactivities
- Human (42850)
- Mouse (27807)
- Rat (22947)
- Monkey (2167)
- Dog (1974)
- Bovine (641)
- Pig (369)
- Rabbit (229)
- Chicken (212)
- Hamster (197)
- Gorilla (179)
- Cow (168)
- Xenopus (165)
- Horse (145)
- Gibbon (141)
- Primate (129)
- Bat (118)
- Zebrafish (113)
- Rhesus Monkey (110)
- Chimpanzee (101)
- X. tropicalis (71)
- Canine (68)
- Porcine (59)
- Guinea Pig (49)
- Sheep (42)
- Orang-Utan (40)
- Feline (25)
- Other (Wide Range) (24)
- Mammalian (20)
- Drosophila (19)
- C. elegans (16)
- Equine (16)
- Goat (12)
- Macaque (11)
- Gerbil (7)
- Fish (6)
- Murine (6)
- Yeast (5)
- All Species (4)
- Cynomolgus (4)
- Opossum (4)
- Baboon (3)
- Ferret (3)
- Frog (3)
- Marmoset (3)
- SARS-CoV-2 (3)
- Avian (2)
- Broad (2)
- Dengue virus (2)
- Escherichia coli (2)
- Fusion proteins containing the Flag Tag (2)
- Plant (2)
- Quail (2)
- SARS-CoV (2)
- Virus (2)
- West Nile Virus (2)
- Yellow Fever Virus (2)
- Amphibian (1)
- Beluga (1)
- Birds (1)
- Canis (1)
- Carp (1)
- Drosophila melanogaster (1)
- Fungi (1)
- Helicobacter pylori (1)
- Insect (1)
- Medaka fish (1)
- Mink (1)
- Pufferfish (1)
- Salmonella Typhimurium (1)
- Spinach (1)
- Squirrel (1)
- Staphylococcus aureus (1)
- Tadpole (1)
- Trichinella spiralis (1)
- Vertebrates (1)
- White Fly (1)
Antibody Hosts
Isotypes
- IgG (23146)
- IgG1 (11919)
- IgG2a (3392)
- IgG2b (2927)
- IgG1, kappa (241)
- Ig (133)
- IgG, kappa (133)
- IgG2a, kappa (79)
- IgG2b, kappa (60)
- IgG3 (56)
- IgG3, kappa (12)
- IgM (11)
- IgY (11)
- IgM, kappa (9)
- IgG1, lambda (8)
- IgG2c (4)
- IgG2 (2)
- IgG2, kappa (2)
- IgG2a, lambda (2)
- IgG2b, lambda (2)
- IgA, kappa (1)
- IgG fraction (1)
- IgG1/IgK (1)
- IgG12b (1)
- IgG4 (1)
- cocktail (1)
Clonalities
Carrier-free
Knockout (KO) Validation
Modifications
- Unmodified (2395)
- Phospho-specific (471)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (37)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (16)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (11)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (9)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (8)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (7)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (6)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (6)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (5)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (5)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgM format, for improved compatibility with existing reagents, assays and techniques. (4)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (3)
- Acetyl K12 (2)
- Acetyl K5 (2)
- Phospho S127 (2)
- Phospho S39 (2)
- Phospho S727 (2)
- Phospho S795 (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG3 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This constant region of this antibody has been modified to bind to Protein A, allowing highly-specific purification of this antibody by Protein A-affinity column. (2)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Human scFv format, for improved compatibility with existing reagents, assays and techniques. (2)
- This full-length, reformatted human antibody was made using the variable domain sequences of the original Human scFv format, for improved compatibility with existing reagents, assays and techniques. (2)
- This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (2)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (2)
- TriMethyl K56 (2)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K27 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Asymmetric DiMethyl R3 (1)
- DiMethyl K385 (1)
- MonoMethyl K36 (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This reformatted human antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- Pan DiMethyl-lysine (1)
- Phospho S1 (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S104 (1)
- Phospho S1177 (1)
- Phospho S1248 (1)
- Phospho S15 (1)
- Phospho S157 (1)
- Phospho S182 (1)
- Phospho S240/244 (1)
- Phospho S243 (1)
- Phospho S280 (1)
- Phospho S33 (1)
- Phospho S33/S37/T41 (1)
- Phospho S37 (1)
- Phospho S376 (1)
- Phospho S425 (1)
- Phospho S428 (1)
- Phospho S455 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S473 (1)
- Phospho S473,Phospho S474,Phospho S472 (1)
- Phospho S5 (1)
- Phospho S51 (1)
- Phospho S529 (1)
- Phospho S612 (1)
- Phospho S62 (1)
- Phospho S73 (1)
- Phospho S80 (1)
- Phospho S82 (1)
- Phospho S89 (1)
- Phospho S957 (1)
- Phospho Ser416 (1)
- Phospho T11 (1)
- Phospho T17 (1)
- Phospho T179 (1)
- Phospho T18/S19 (1)
- Phospho T183/T172 (1)
- Phospho T1989 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T24,Phospho T32,Phospho T28 (1)
- Phospho T286 (1)
- Phospho T308 (1)
- Phospho T32 (1)
- Phospho T320 (1)
- Phospho T37/46 (1)
- Phospho T389 (1)
- Phospho T45 (1)
- Phospho T58 (1)
- Phospho T6 (1)
- Phospho T69/71 (1)
- Phospho T69/T71 (1)
- Phospho T70 (1)
- Phospho T91 (1)
- Phospho Y1007/1008 (1)
- Phospho Y1217 (1)
- Phospho Y1349 (1)
- Phospho Y15 (1)
- Phospho Y182 (1)
- Phospho Y207 (1)
- Phospho Y245 (1)
- Phospho Y412 (1)
- Phospho Y694 (1)
- Phospho Y705 (1)
- This chimeric human antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Armenian Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Armenian Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgM format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv antibody fragment format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This is a chimeric antibody created to reduce immunogenicity during in vivo applications. (1)
- This is a chimeric mouse antibody, based on the original rat IgG2b format, created for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG3 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse scFv antibody fragment format, for improved compatibility with existing reagents, assays and techniques. (1)
- phospho T1079,Phospho T1041 (1)
Assay Types
Families
- Druggable Genome (18365)
- Transmembrane (6831)
- Transcription Factors (4328)
- Secreted Protein (2917)
- ES Cell Differentiation/IPS (2364)
- Protein Kinase (1996)
- Stem cell - Pluripotency (1316)
- Protease (1312)
- GPCR (544)
- Adult stem cells (513)
- Embryonic stem cells (336)
- Nuclear Hormone Receptor (334)
- Phosphatase (284)
- Cancer stem cells (260)
- Induced pluripotent stem cells (197)
- P450 (193)
- Stem cell relevant signaling - JAK/STAT signaling pathway (154)
- Ion Channels: Other (151)
- Stem cell relevant signaling - DSL/Notch pathway (149)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (79)
- Ion Channels: Potassium (75)
- Ion Channels: Transient receptor potential (74)
- Stem cell relevant signaling - Wnt Signaling pathway (59)
- Ion Channels: Cys-loop Receptors (43)
- Ion Channels: Glutamate Receptors (33)
- Ion Channels: Sodium (22)
- Ion Channels: Calcium (10)
- Ion Channels: Cyclic nucleotide gated (10)
- Ion Channels: ATP Receptors (9)
Pathways
- Metabolic pathways (3068)
- Pathways in cancer (2298)
- MAPK signaling pathway (1331)
- Focal adhesion (1178)
- Prostate cancer (1079)
- Neurotrophin signaling pathway (937)
- Colorectal cancer (915)
- T cell receptor signaling pathway (876)
- Toll-like receptor signaling pathway (862)
- Pancreatic cancer (839)
- Chronic myeloid leukemia (815)
- ErbB signaling pathway (815)
- Regulation of actin cytoskeleton (809)
- Melanoma (790)
- Cell adhesion molecules (CAMs) (774)
- Cytokine-cytokine receptor interaction (773)
- Endometrial cancer (764)
- Insulin signaling pathway (764)
- Chemokine signaling pathway (739)
- Glioma (737)
- Non-small cell lung cancer (726)
- Cell cycle (723)
- Apoptosis (717)
- B cell receptor signaling pathway (712)
- Bladder cancer (702)
- Progesterone-mediated oocyte maturation (685)
- Acute myeloid leukemia (642)
- Fc gamma R-mediated phagocytosis (620)
- Wnt signaling pathway (619)
- Small cell lung cancer (613)
- Hematopoietic cell lineage (609)
- Leukocyte transendothelial migration (606)
- Renal cell carcinoma (599)
- Jak-STAT signaling pathway (593)
- Endocytosis (588)
- Fc epsilon RI signaling pathway (588)
- Alzheimer's disease (579)
- Natural killer cell mediated cytotoxicity (545)
- Huntington's disease (527)
- p53 signaling pathway (527)
- GnRH signaling pathway (515)
- Neuroactive ligand-receptor interaction (512)
- VEGF signaling pathway (496)
- Melanogenesis (492)
- Calcium signaling pathway (483)
- Oocyte meiosis (476)
- Amyotrophic lateral sclerosis (ALS) (472)
- Adherens junction (453)
- Adipocytokine signaling pathway (451)
- Gap junction (447)
- Purine metabolism (440)
- Thyroid cancer (439)
- mTOR signaling pathway (398)
- Ubiquitin mediated proteolysis (391)
- Pyrimidine metabolism (372)
- Vascular smooth muscle contraction (371)
- Type II diabetes mellitus (367)
- Parkinson's disease (366)
- Tight junction (348)
- Pathogenic Escherichia coli infection (338)
- Glycolysis / Gluconeogenesis (332)
- Basal cell carcinoma (328)
- Axon guidance (327)
- Long-term potentiation (321)
- Epithelial cell signaling in Helicobacter pylori infection (315)
- Long-term depression (312)
- Prion diseases (307)
- Lysosome (296)
- Complement and coagulation cascades (293)
- Arginine and proline metabolism (291)
- Primary immunodeficiency (290)
- RIG-I-like receptor signaling pathway (287)
- Antigen processing and presentation (277)
- TGF-beta signaling pathway (274)
- NOD-like receptor signaling pathway (265)
- Systemic lupus erythematosus (255)
- Dilated cardiomyopathy (244)
- PPAR signaling pathway (244)
- Valine (243)
- ECM-receptor interaction (239)
- leucine and isoleucine degradation (238)
- Drug metabolism - cytochrome P450 (231)
- Hypertrophic cardiomyopathy (HCM) (229)
- Metabolism of xenobiotics by cytochrome P450 (226)
- Glycerolipid metabolism (223)
- Oxidative phosphorylation (222)
- Cytosolic DNA-sensing pathway (221)
- Nucleotide excision repair (217)
- Phosphatidylinositol signaling system (216)
- Dorso-ventral axis formation (211)
- Fatty acid metabolism (208)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (203)
- Viral myocarditis (203)
- Tryptophan metabolism (199)
- Autoimmune thyroid disease (195)
- Arachidonic acid metabolism (190)
- Spliceosome (185)
- Alanine (179)
- Hedgehog signaling pathway (179)
- aspartate and glutamate metabolism (179)
- Type I diabetes mellitus (175)
- Inositol phosphate metabolism (174)
- Lysine degradation (174)
- DNA replication (167)
- RNA degradation (167)
- Butanoate metabolism (166)
- Tyrosine metabolism (166)
- Propanoate metabolism (161)
- Retinol metabolism (160)
- Mismatch repair (156)
- Base excision repair (155)
- Glutathione metabolism (155)
- Pyruvate metabolism (154)
- Notch signaling pathway (149)
- Histidine metabolism (146)
- Cardiac muscle contraction (134)
- Allograft rejection (127)
- Glycine (127)
- serine and threonine metabolism (127)
- Renin-angiotensin system (126)
- ABC transporters (125)
- Proteasome (123)
- Homologous recombination (120)
- Vibrio cholerae infection (119)
- Graft-versus-host disease (117)
- One carbon pool by folate (116)
- Starch and sucrose metabolism (113)
- beta-Alanine metabolism (112)
- Cysteine and methionine metabolism (105)
- Drug metabolism - other enzymes (102)
- Pentose phosphate pathway (102)
- Fructose and mannose metabolism (101)
- Regulation of autophagy (96)
- Amino sugar and nucleotide sugar metabolism (95)
- Citrate cycle (TCA cycle) (94)
- Linoleic acid metabolism (89)
- Maturity onset diabetes of the young (85)
- Nicotinate and nicotinamide metabolism (81)
- Galactose metabolism (78)
- Sphingolipid metabolism (78)
- Ribosome (76)
- Circadian rhythm - mammal (75)
- Nitrogen metabolism (75)
- Terpenoid backbone biosynthesis (75)
- Primary bile acid biosynthesis (74)
- Glycerophospholipid metabolism (69)
- Aminoacyl-tRNA biosynthesis (63)
- Folate biosynthesis (63)
- SNARE interactions in vesicular transport (63)
- Taste transduction (62)
- N-Glycan biosynthesis (60)
- Fatty acid elongation in mitochondria (59)
- Asthma (57)
- Sulfur metabolism (57)
- Porphyrin and chlorophyll metabolism (56)
- Non-homologous end-joining (54)
- Phenylalanine metabolism (54)
- Caffeine metabolism (53)
- Androgen and estrogen metabolism (50)
- Synthesis and degradation of ketone bodies (47)
- Other glycan degradation (46)
- Olfactory transduction (43)
- Glyoxylate and dicarboxylate metabolism (40)
- Selenoamino acid metabolism (39)
- Methane metabolism (38)
- Biosynthesis of unsaturated fatty acids (36)
- Basal transcription factors (35)
- RNA polymerase (35)
- Glycosaminoglycan degradation (33)
- Ascorbate and aldarate metabolism (31)
- Limonene and pinene degradation (31)
- Pantothenate and CoA biosynthesis (29)
- Ether lipid metabolism (28)
- Riboflavin metabolism (27)
- Pentose and glucuronate interconversions (26)
- Cyanoamino acid metabolism (24)
- Taurine and hypotaurine metabolism (23)
- C21-Steroid hormone metabolism (22)
- Steroid biosynthesis (21)
- O-Glycan biosynthesis (20)
- Fatty acid biosynthesis (19)
- Glycosphingolipid biosynthesis - ganglio series (17)
- Vitamin B6 metabolism (17)
- D-Glutamine and D-glutamate metabolism (15)
- Glycosphingolipid biosynthesis - lacto and neolacto series (15)
- Keratan sulfate biosynthesis (12)
- Chondroitin sulfate biosynthesis (11)
- leucine and isoleucine biosynthesis (11)
- Thiamine metabolism (10)
- Glycosphingolipid biosynthesis - globo series (9)
- alpha-Linolenic acid metabolism (9)
- Heparan sulfate biosynthesis (8)
- Phenylalanine (7)
- Protein export (7)
- tyrosine and tryptophan biosynthesis (7)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (6)
- Biotin metabolism (3)
- Lysine biosynthesis (3)
- O-Mannosyl glycan biosynthesis (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)