Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431] |
Rabbit Polyclonal GATA3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GATA3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human GATA3. The immunogen is located within amino acids 340 - 390 of GATA3. |
Rabbit Polyclonal Antibody against SOX2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-119 amino acids from the N-terminal region of human SOX2. |
Rabbit polyclonal KLF4 Antibody (N-term C74)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4. |
Rabbit polyclonal SOX-9 (Ser181) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human SOX-9 around the phosphorylation site of serine 181 (R-K-SP-V-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Anti-ERBB3 (phospho-Tyr1328) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 1328 (P-D-Y(p)-W-H) derived from Human Her3/ErbB3. |
| Modifications | Phospho-specific |
Rabbit polyclonal PAX3 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PAX3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 98-126 amino acids from the N-terminal region of human PAX3. |
Rabbit Polyclonal anti-GATA2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA2 antibody: synthetic peptide directed towards the N terminal of human GATA2. Synthetic peptide located within the following region: PYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSA |
Rabbit Polyclonal anti-GLI2 antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE |
Rabbit Polyclonal Anti-WNT7B Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
EGFR L858R mouse monoclonal antibody,clone UMAB233
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal anti-WNT1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human WNT1. |
Active filters
Category
- Antibodies
Reactivities
- Mouse
Applications
- IHC
Families
- Adult stem cells
Filter by
Target Symbol
- GLI1 (39)
- EGFR (33)
- HES1 (24)
- HGF (22)
- GATA3 (21)
- NOTCH1 (20)
- CDX2 (19)
- ERBB3 (19)
- SOX9 (12)
- GLI2 (11)
- BDNF (7)
- SMURF2 (7)
- SOX2 (7)
- LEF1 (6)
- BMP4 (5)
- HDAC1 (5)
- TAL1 (5)
- CD44 (4)
- KLF4 (4)
- PAX3 (4)
- HNF1A (3)
- MAP2 (3)
- POU5F1 (3)
- SFRP1 (3)
- EGF (2)
- FGF7 (2)
- GATA1 (2)
- LIF (2)
- PAX7 (2)
- WNT1 (2)
- WNT2 (2)
- WNT3A (2)
- WNT6 (2)
- APOE (1)
- BMP2 (1)
- BMP6 (1)
- CCN4 (1)
- CD4 (1)
- CD9 (1)
- DKK2 (1)
- FGF21 (1)
- FGF4 (1)
- GATA2 (1)
- GDF3 (1)
- GDF9 (1)
- GLI3 (1)
- IGFBP1 (1)
- KIT (1)
- PDGFC (1)
- SFRP4 (1)
- SFRP5 (1)
- SOX10 (1)
- WNT5A (1)
- WNT7B (1)
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (140)
- Basal cell carcinoma (73)
- Hedgehog signaling pathway (68)
- Endocytosis (63)
- Cytokine-cytokine receptor interaction (62)
- Melanoma (62)
- Focal adhesion (58)
- ErbB signaling pathway (54)
- Dorso-ventral axis formation (53)
- Calcium signaling pathway (52)
- Notch signaling pathway (49)
- MAPK signaling pathway (46)
- Prostate cancer (42)
- Endometrial cancer (41)
- Regulation of actin cytoskeleton (40)
- Adherens junction (39)
- Colorectal cancer (39)
- Gap junction (36)
- Bladder cancer (35)
- Glioma (35)
- Non-small cell lung cancer (35)
- Pancreatic cancer (35)
- Epithelial cell signaling in Helicobacter pylori infection (33)
- GnRH signaling pathway (33)
- Maturity onset diabetes of the young (27)
- Renal cell carcinoma (22)
- Wnt signaling pathway (22)
- Prion diseases (20)
- Melanogenesis (18)
- TGF-beta signaling pathway (14)
- Huntington's disease (12)
- Acute myeloid leukemia (8)
- Antigen processing and presentation (8)
- Cell adhesion molecules (CAMs) (8)
- Hematopoietic cell lineage (8)
- Allograft rejection (7)
- Autoimmune thyroid disease (7)
- Graft-versus-host disease (7)
- Neurotrophin signaling pathway (7)
- Type I diabetes mellitus (7)
- Ubiquitin mediated proteolysis (7)
- Viral myocarditis (7)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (6)
- Thyroid cancer (6)
- Cell cycle (5)
- Chronic myeloid leukemia (5)
- ECM-receptor interaction (4)
- Jak-STAT signaling pathway (2)
- Alzheimer's disease (1)
- Primary immunodeficiency (1)
- T cell receptor signaling pathway (1)