Germany
Japan
United Kingdom
China
Antibodies
View as table Download
c-Myc (MYC) chicken polyclonal antibody, FITC
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | FITC |
| Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. After repeated injections, immune eggs were collected, from which the IgY fractions were prepared. |
c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Immunogen | This antibody was purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. |
Rabbit polyclonal SOX4 Antibody (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOX4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 269-297 amino acids from the Central region of human SOX4. |
Anti-Human BMP-7 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CHO cells derived Recombinant Human BMP-7 |
CD4 mouse monoclonal antibody, clone B-A1, Purified
| Applications | FC, IHC |
| Reactivities | Human |
EGF rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Immunogen | Recombinant EGF precursor from Suberites domuncula. |
EGF rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, WB |
| Immunogen | Recombinant EGF precursor from Suberites domuncula. |
EGF rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant hEGF (human EGF). |
EGF rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) recombinant hEGF (human EGF). |
c-Myc (MYC) rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, WB |
| Conjugation | Biotin |
| Immunogen | Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc. |
c-Myc (MYC) rabbit polyclonal antibody, HRP
| Applications | ELISA, IHC, WB |
| Conjugation | HRP |
| Immunogen | Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc. |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, FITC
| Applications | FC, IF, IHC |
| Reactivities | Human |
| Conjugation | FITC |
Rabbit polyclonal Transcription Factor 3 / E2A (Thr355) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human E2A around the phosphorylation site of threonine 355 (P-S-TP-P-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal FOXA2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2. |
Rabbit polyclonal FOXA2 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2. |
Rabbit Polyclonal Anti-SOX10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SOX10 Antibody: synthetic peptide directed towards the middle region of human SOX10. Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT |
CD4 mouse monoclonal antibody, clone CA-4, Purified
| Applications | IF, IHC |
| Reactivities | Human |
CD4 mouse monoclonal antibody, clone EDU-2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
Active filters
Category
- Antibodies
Applications
- IHC
Families
- Induced pluripotent stem cells
Filter by
Target Symbol
- CD4 (85)
- MYC (32)
- EGF (16)
- SOX9 (15)
- CD38 (13)
- PDX1 (13)
- KLF5 (12)
- OTX2 (11)
- FOXA2 (10)
- POU5F1 (10)
- BDNF (9)
- SOX2 (9)
- GATA4 (7)
- BMP4 (6)
- TCF3 (6)
- WNT3A (6)
- KLF4 (5)
- NANOG (5)
- SOX4 (5)
- FGF4 (4)
- AXIN2 (3)
- BMP2 (3)
- BMP7 (3)
- SOX10 (3)
- WNT8A (3)
- BMP5 (2)
- BMP6 (2)
- DNMT3B (2)
- DPPA2 (2)
- GDF3 (2)
- SOX11 (2)
- BMP8B (1)
- NODAL (1)
- PDGFC (1)
- SOX7 (1)
- UTF1 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Modifications
Pathways
- Hematopoietic cell lineage (101)
- Antigen processing and presentation (85)
- Cell adhesion molecules (CAMs) (85)
- Primary immunodeficiency (85)
- T cell receptor signaling pathway (85)
- Pathways in cancer (73)
- MAPK signaling pathway (61)
- Endometrial cancer (51)
- TGF-beta signaling pathway (50)
- Bladder cancer (48)
- ErbB signaling pathway (48)
- Wnt signaling pathway (44)
- Acute myeloid leukemia (35)
- Colorectal cancer (35)
- Cell cycle (32)
- Chronic myeloid leukemia (32)
- Jak-STAT signaling pathway (32)
- Small cell lung cancer (32)
- Thyroid cancer (32)
- Hedgehog signaling pathway (26)
- Cytokine-cytokine receptor interaction (23)
- Maturity onset diabetes of the young (23)
- Basal cell carcinoma (21)
- Melanoma (21)
- Regulation of actin cytoskeleton (21)
- Endocytosis (19)
- Focal adhesion (17)
- Gap junction (17)
- Prostate cancer (17)
- Glioma (16)
- Non-small cell lung cancer (16)
- Pancreatic cancer (16)
- Metabolic pathways (15)
- Calcium signaling pathway (13)
- Nicotinate and nicotinamide metabolism (13)
- Type II diabetes mellitus (13)
- Melanogenesis (12)
- Huntington's disease (9)
- Neurotrophin signaling pathway (9)
- Cysteine and methionine metabolism (2)