Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit Polyclonal Anti-EIF4E2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EIF4E2 antibody: synthetic peptide directed towards the N terminal of human EIF4E2. Synthetic peptide located within the following region: KDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQY |
IKBKB Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IKBKB |
Rabbit Polyclonal Antibody against EIF4E2 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EIF4E2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-41 amino acids from the N-terminal region of human EIF4E2. |
FOXO1 / FKHR Mouse Monoclonal (aa242-655) (7h3) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal FKHR (Phospho-Ser256) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FKHR around the phosphorylation site of serine 256 (A-A-SP-M-D). |
| Modifications | Phospho-specific |
Rabbit polyclonal antibody to IKK beta (inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 493 and 739 of IKK beta (Uniprot ID#O14920) |
Anti-FOXO1 (Phospho-Ser319) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 319 (T-S-S(p)-N-A) derived from Human FKHR/FOXO1A. |
| Modifications | Phospho-specific |
Rabbit polyclonal FOXO1/3/4-pan (Ab-24/32) antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human FOXO1/3/4-pan. |
p38 (CRK) (CRK-II, pTry221) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Rabbit anti-FKHR (Phospho-Ser256) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanFKHR around the phosphorylation site of serine 256 (A-A-SP-M-D). |
| Modifications | Phospho-specific |
Rabbit anti-FKHR (Phospho-Ser319) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanFKHR around the phosphorylation site of serine 319 (T-S-SP-N-A). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SREBF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SREBF1 antibody: synthetic peptide directed towards the middle region of human SREBF1. Synthetic peptide located within the following region: DAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSR |
CBL rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Synthesized non-phosphopeptide derived from human c-Cbl around the phosphorylation site of tyrosine 700 (T-E-YP-M-T) |
CBL rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | Synthesized non-phosphopeptide derived from human c-Cbl around the phosphorylation site of tyrosine 700 (T-E-YP-M-T) |
p38 (CRK) (CRK-II) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 200-250 of Human Crk2. |
Rabbit anti-ELK1 (Phospho-Thr417) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanElk-1 around the phosphorylation site of threonine 417 (L-S-TP-P-V). |
| Modifications | Phospho-specific |
USD 465.00
In Stock
Anti-FOXO1 (Phospho-Ser256) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 256 (A-A-S(p)-M-D) derived from Human FKHR. |
| Modifications | Phospho-specific |
USD 379.00
In Stock
USD 420.00
5 Days
USD 420.00
5 Days
USD 159.00
In Stock
Anti-PRKAR1A (PKA regulatory subunit I alpha) mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
