Germany
Japan
United Kingdom
China
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
| Applications | FC, IHC |
| Reactivities | Human |
Antibodies
Download
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
CD45 (PTPRC) (CD45RC) mouse monoclonal antibody, clone MT2, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
USD 300.00
In Stock
Integrin alpha E (ITGAE) mouse monoclonal antibody, clone B-ly7, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal GRB2 (Ab-159) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GRB2 around the phosphorylation site of serine 159 (K-S-SP-A-P). |
Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
CD16 (FCGR3A) mouse monoclonal antibody, clone c127, Aff - Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit Polyclonal antibody to ARPC2 (actin related protein 2/3 complex, subunit 2, 34kDa)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 14 and 300 of ARPC2 (Uniprot ID#O15144) |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
Rabbit anti-AKT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT1 |
AKT1 (C-term) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
USD 450.00
2 Weeks
Rabbit polyclonal Raf1 (Ab-621) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
Rabbit polyclonal Akt (Ab-129) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A). |
Rabbit polyclonal Akt (Ab-326) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R). |
Rabbit polyclonal Dynamin-1 (Ser774) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DYN1 around the phosphorylation site of serine 774 (R-R-SP-P-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal LYN Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LYN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 32-62 amino acids from the N-terminal region of human LYN. |
Rabbit anti-PRKCE Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PRKCE |
Phospho-VASP-S239 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S239 of human VASP |
| Modifications | Phospho-specific |
CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, Purified
| Applications | FC, IHC, IP, WB |
| Reactivities | Human |
Cofilin 1 (CFL1) (+ Cofilin 2) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cofilin1/Cofilin2 around the phosphorylation site of Tyrosine 86~90(A-T-Y-E-T). |
Cofilin 1 (CFL1) (+ Cofilin 2) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cofilin1/Cofilin2 around the phosphorylation site of Tyrosine 86~90(A-T-Y-E-T). |
MEK1 (MAP2K1) (N-term) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Xenopus |
| Immunogen | MAP2K1 antibody was raised against synthetic peptide derived from sequence near the amino-terminus of human MEK1, conjugated to KLH |
Active filters
Category
- Antibodies
Applications
- IHC
Pathways
- Fc gamma R-mediated phagocytosis
Filter by
Target Symbol
- MAP2K1 (183)
- PTPRC (76)
- AKT1 (73)
- PIK3CG (54)
- FCGR2A (46)
- DNM1L (39)
- PIK3R5 (37)
- RPS6KB1 (36)
- LIMK1 (33)
- PRKCE (32)
- MAPK1 (29)
- PIK3CD (28)
- PIK3CA (23)
- VASP (22)
- PAK1 (20)
- CFL1 (16)
- FCGR1A (14)
- AKT2 (13)
- DOCK2 (13)
- PIKFYVE (12)
- AKT3 (11)
- RAF1 (11)
- WASL (11)
- PIK3R1 (9)
- PLPP1 (9)
- PRKCA (9)
- SPHK1 (9)
- MAPK3 (8)
- GSN (7)
- LIMK2 (7)
- NCF1 (7)
- PRKCD (6)
- SYK (6)
- ARF6 (5)
- ARPC5 (5)
- CRK (4)
- CRKL (4)
- FCGR3A (4)
- GAB2 (4)
- MARCKS (4)
- AMPH (3)
- DNM1 (3)
- DNM3 (3)
- FCGR2B (3)
- PLCG1 (3)
- WASF1 (3)
- ARPC2 (2)
- ASAP3 (2)
- HCK (2)
- LYN (2)
- PIK3R3 (2)
- PLA2G6 (2)
- PRKCB (2)
- RAC1 (2)
- SPHK2 (2)
- VAV2 (2)
- WASF2 (2)
- WASF3 (2)
- ARPC1A (1)
- ARPC3 (1)
- ARPC4 (1)
- CDC42 (1)
- CFL2 (1)
- DNM2 (1)
- INPP5D (1)
- MARCKSL1 (1)
- PIK3CB (1)
- PIK3R2 (1)
- PIP5K1A (1)
- PIP5K1B (1)
- PIP5K1C (1)
- PLA2G4A (1)
- PLA2G4D (1)
- PLA2G4E (1)
- PLCG2 (1)
- PLD1 (1)
- PLD2 (1)
- PLPP2 (1)
- PRKCG (1)
- RAC2 (1)
- RPS6KB2 (1)
- VAV1 (1)
- VAV3 (1)
- WAS (1)