Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 158 results

Page 1 of 4

(reset)

FBP1 Rabbit Polyclonal Antibody

TA346042

USD 410.00

5 Days

Rabbit Polyclonal Anti-FBP1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-FBP1 antibody: synthetic peptide directed towards the N terminal of human FBP1. Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA

1 / 3

2 / 3

3 / 3

Previous Next

PGLS Rabbit Polyclonal Antibody

TA344307

USD 475.00

5 Days

Rabbit Polyclonal Anti-PGLS Antibody - middle region

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PGLS antibody: synthetic peptide directed towards the middle region of human PGLS. Synthetic peptide located within the following region: AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL

1 / 3

2 / 3

3 / 3

Previous Next

RPE Rabbit Polyclonal Antibody

TA345128

USD 475.00

5 Days

Rabbit Polyclonal Anti-RPE Antibody - N-terminal region

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-RPE antibody: synthetic peptide directed towards the N terminal of human RPE. Synthetic peptide located within the following region: ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ

1 / 2

2 / 2

Previous Next

RPE Rabbit Polyclonal Antibody

TA345129

USD 475.00

5 Days

Rabbit Polyclonal Anti-RPE Antibody - middle region

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-RPE antibody: synthetic peptide directed towards the middle region of human RPE. Synthetic peptide located within the following region: MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK

1 / 2

2 / 2

Previous Next

PRPS2 Rabbit Polyclonal Antibody

TA346065

USD 475.00

5 Days

Rabbit Polyclonal Anti-PRPS2 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the middle region of human PRPS2. Synthetic peptide located within the following region: VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI

1 / 2

2 / 2

Previous Next

ALDOB Rabbit Polyclonal Antibody

TA590002

USD 409.00

In Stock

Rabbit Polyclonal Aldolase B Antibody

Applications	ELISA, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated
Immunogen	DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

PRPS2 Rabbit Polyclonal Antibody

TA308129

USD 415.00

In Stock

Rabbit polyclonal antibody to PRPS2 (phosphoribosyl pyrophosphate synthetase 2)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 243 of PRPS2 (Uniprot ID#P11908)

1 / 3

2 / 3

3 / 3

Previous Next

PFKL Rabbit Polyclonal Antibody

TA308631

USD 415.00

5 Days

Rabbit Polyclonal antibody to PFKL (phosphofructokinase, liver)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 428 and 674 of PFKL (Uniprot ID#P17858)

1 / 3

2 / 3

3 / 3

Previous Next

Glucose 6 Phosphate Dehydrogenase (G6PD) Mouse Monoclonal Antibody [Clone ID: 2H7]

TA336922

USD 424.00

5 Days

Mouse Monoclonal Glucose 6 Phosphate Dehydrogenase Antibody (2H7) Cytosol Marker

Applications	ELISA, FC, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

TA336922 is a replacement of AM06697SU-N.

PGLS Rabbit Polyclonal Antibody

TA315287

USD 345.00

In Stock

Rabbit polyclonal anti-PGLS antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human PGLS.

1 / 2

2 / 2

Previous Next

Aldolase (ALDOA) Mouse Monoclonal Antibody [Clone ID: 2E6]

AM31917PU-N

USD 480.00

2 Weeks

Aldolase (ALDOA) mouse monoclonal antibody, clone 2E6, Purified

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse

1 / 3

2 / 3

3 / 3

Previous Next

PFKL Rabbit Polyclonal Antibody

AP20430PU-N

USD 370.00

2 Weeks

PFKL rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat

Glucose 6 Phosphate Dehydrogenase (G6PD) (305-318) Goat Polyclonal Antibody

AP22547PU-N

USD 440.00

2 Weeks

Glucose 6 Phosphate Dehydrogenase (G6PD) (305-318) goat polyclonal antibody, Aff - Purified

Applications	ELISA, IHC, WB
Reactivities	Human, Monkey
Immunogen	Synthetic peptide from an internal region (aa 305-318) of human G6PD

1 / 3

2 / 3

3 / 3

Previous Next

Glucose 6 Phosphate Dehydrogenase (G6PD) (308-320) Goat Polyclonal Antibody

AP22548PU-N

USD 440.00

2 Weeks

Glucose 6 Phosphate Dehydrogenase (G6PD) (308-320) goat polyclonal antibody, Aff - Purified

Applications	ELISA, IHC, WB
Reactivities	Human, Monkey, Xenopus
Immunogen	Synthetic peptide from an internal region (aa. 308-320) of human G6PD

1 / 2

2 / 2

Previous Next

Aldolase C (ALDOC) (C-term) Rabbit Polyclonal Antibody

AP22780PU-N

USD 440.00

2 Weeks

Aldolase C (ALDOC) (C-term) rabbit polyclonal antibody, Ig Fraction

Applications	IHC, WB
Reactivities	Human
Immunogen	ALDOC antibody was raised against kLH conjugated synthetic peptide selected from the C-terminal region of Human ALDOC. Epitope: C-Terminus

1 / 2

2 / 2

Previous Next

PGD Rabbit Polyclonal Antibody

TA308104

USD 415.00

5 Days

Rabbit Polyclonal antibody to PGD (phosphogluconate dehydrogenase)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 201 of PGD (Uniprot ID#P52209)

1 / 3

2 / 3

3 / 3

Previous Next

Aldolase (ALDOA) Rabbit Polyclonal Antibody

TA324726

USD 450.00

5 Days

Rabbit polyclonal Aldolase (ALDOA) Antibody (N-term)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This Aldolase (ALDOA) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 66-95 amino acids from the N-terminal region of human Aldolase (ALDOA).

1 / 3

2 / 3

3 / 3

Previous Next

PFKL Rabbit Polyclonal Antibody

TA325027

USD 450.00

5 Days

Rabbit polyclonal PFKL Antibody (C-term L684)

Applications	IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This PFKL antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 669-699 amino acids from the C-terminal region of human PFKL.

1 / 2

2 / 2

Previous Next

PFKL Rabbit Polyclonal Antibody

AP06677PU-N

USD 370.00

2 Weeks

PFKL rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	Synthetic peptide, corresponding to amino acids 700-750 of Human PFKL.

1 / 2

2 / 2

Previous Next

TKTL1 Rabbit Polyclonal Antibody

TA335653

USD 375.00

5 Days

Rabbit Polyclonal Anti-TKTL1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-TKTL1 Antibody: synthetic peptide directed towards the middle region of human TKTL1. Synthetic peptide located within the following region: QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA

1 / 2

2 / 2

Previous Next

H6PD Rabbit Polyclonal Antibody

TA339891

USD 375.00

5 Days

Rabbit Polyclonal Anti-H6PD Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-H6PD antibody: synthetic peptide directed towards the N terminal of human H6PD. Synthetic peptide located within the following region: HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW

1 / 2

2 / 2

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI5G9]

CF501127

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI4B11]

CF501128

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI8G7]

CF501135

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI8G7 (formerly 8G7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI7G10]

CF501136

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI7G10 (formerly 7G10)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI5A11]

CF501137

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI5A11 (formerly 5A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Glucose 6 phosphate isomerase (GPI) Mouse Monoclonal Antibody [Clone ID: OTI2D2]

CF501171

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GPI mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

H6PD Mouse Monoclonal Antibody [Clone ID: OTI2C12]

CF501213

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) H6PD mouse monoclonal antibody, clone OTI2C12 (formerly 2C12)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

H6PD Mouse Monoclonal Antibody [Clone ID: OTI1H6]

CF501241

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) H6PD mouse monoclonal antibody, clone OTI1H6 (formerly 1H6)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

H6PD Mouse Monoclonal Antibody [Clone ID: OTI2A7]

CF501257

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) H6PD mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

ALDOB Mouse Monoclonal Antibody [Clone ID: OTI3C6]

CF502908

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDOB mouse monoclonal antibody, clone OTI3C6 (formerly 3C6)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

ALDOB Mouse Monoclonal Antibody [Clone ID: OTI3E10]

CF502909

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ALDOB mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

PFKP Mouse Monoclonal Antibody [Clone ID: OTI1F2]

CF503979

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PFKP mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 17

2 / 17

3 / 17

4 / 17

5 / 17

6 / 17

7 / 17

8 / 17

9 / 17

10 / 17

11 / 17

12 / 17

13 / 17

14 / 17

15 / 17

16 / 17

17 / 17

Previous Next

PFKP Mouse Monoclonal Antibody [Clone ID: OTI3A12]

CF503980

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PFKP mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

PFKP Mouse Monoclonal Antibody [Clone ID: OTI2E10]

CF503981

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PFKP mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 15

2 / 15

3 / 15

4 / 15

5 / 15

6 / 15

7 / 15

8 / 15

9 / 15

10 / 15

11 / 15

12 / 15

13 / 15

14 / 15

15 / 15

Previous Next

PFKP Mouse Monoclonal Antibody [Clone ID: OTI1D6]

CF503982

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PFKP mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

PFKP Mouse Monoclonal Antibody [Clone ID: OTI3G8]

CF503983

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PFKP mouse monoclonal antibody, clone OTI3G8 (formerly 3G8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

PFKP Mouse Monoclonal Antibody [Clone ID: OTI2E8]

CF503984

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PFKP mouse monoclonal antibody, clone OTI2E8 (formerly 2E8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

PFKP Mouse Monoclonal Antibody [Clone ID: OTI1A11]

CF503985

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PFKP mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

PFKP Mouse Monoclonal Antibody [Clone ID: OTI5F7]

CF503986

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PFKP mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

PFKP Mouse Monoclonal Antibody [Clone ID: OTI2F2]

CF503998

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PFKP mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

PFKP Mouse Monoclonal Antibody [Clone ID: OTI3H8]

CF503999

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PFKP mouse monoclonal antibody, clone OTI3H8 (formerly 3H8)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

PGD Mouse Monoclonal Antibody [Clone ID: OTI2A5]

CF505578

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PGD mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Transaldolase 1 (TALDO1) Mouse Monoclonal Antibody [Clone ID: OTI1A5]

CF809856

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TALDO1 mouse monoclonal antibody, clone OTI1A5

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Transaldolase 1 (TALDO1) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

CF809857

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TALDO1 mouse monoclonal antibody, clone OTI2E4

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Transaldolase 1 (TALDO1) Mouse Monoclonal Antibody [Clone ID: OTI1E5]

CF809858

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TALDO1 mouse monoclonal antibody, clone OTI1E5

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Aldolase (ALDOA) Rabbit Polyclonal Antibody

TA321043

USD 345.00

In Stock

Anti-ALDOA rabbit polyclonal antibody

Applications	ELISA, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 200 amino acids of human aldolase A, fructose-bisphosphate

Aldolase (ALDOA) Rabbit Polyclonal Antibody

TA321044

USD 345.00

In Stock

Anti-ALDOA rabbit polyclonal antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to C terminal 200 amino acids of human aldolase A, fructose-bisphosphate

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

ALDOB Rabbit Polyclonal Antibody

TA321045

USD 345.00

In Stock

Anti-ALDOB Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 109-122 amino acids of human aldolase B, fructose-bisphosphate

ALDOB Rabbit Polyclonal Antibody

TA321046

USD 345.00

In Stock

Anti-ALDOB Rabbit Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region derived from 109-122 amino acids of human aldolase B, fructose-bisphosphate

1 / 3

2 / 3

3 / 3

Previous Next

1 - 50 of 158 results

Page 1 of 4