Germany
Japan
United Kingdom
China
Antibodies
Download
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit Polyclonal antibody to GAPDH (glyceraldehyde-3-phosphate dehydrogenase)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 335 of GAPDH (Uniprot ID#P04406) |
Calbindin (CALB1) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Human, Monkey, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to PDE6D (phosphodiesterase 6D, cGMP-specific, rod, delta)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 150 of PDE6D (Uniprot ID#O43924) |
Rabbit Polyclonal Anti-CYSLTR1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Gibbon, Mouse, Panda (90%); Rat, Bovine, Elephant, Rabbit, Pig (85%). |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%). |
Rabbit Polyclonal Antibody against NANOG (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NANOG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-49 amino acids from the N-terminal region of human NANOG. |
Goat Polyclonal Anti-Cathepsin D Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 275 aa to the C-terminus of human Cathepsin D produced in E. coli. |
Rabbit Polyclonal Antibody against PYGM (C-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PYGM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 698-727 amino acids from the C-terminal region of human PYGM. |
Dopamine Receptor D3 / DRD3 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | DRD3 / Dopamine Receptor D3 antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human DRD3 / Dopamine Receptor D3. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit (94%); Rat, Pig, Opossum (88%). |
GNAT3 / Gustducin Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | GNAT3 / Gustducin antibody was raised against synthetic peptide C-KNQFLDLNLKKEDKE from an internal region of human GNAT3 (NP_001095856.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum (100%); Bat, Lizard (93%); Platypus (87%); Turkey, Chicken (80%). |
ADAMTS1 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%). |
FSP1 / S100A4 Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Gorilla, Horse, Human, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | S100A4 / FSP1 antibody was raised against synthetic peptide CNEFFEGFPDKQP from the C-terminus of human S100A4 / FSP1 (NP_002952.1; NP_062427.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Marmoset, Hamster, Elephant, Bat (92%); Mouse, Rat (85%). |
Goat Polyclonal Anti-Rab27 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 120 aa to the C-terminus of mouse Rab27a and rab27b produced in E. coli. |
Dopamine Receptor D1 / DRD1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD1 / Dopamine Receptor D1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human DRD1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon, Marmoset (95%); Elephant (90%); Dog, Rabbit (85%); Horse (80%). |
Goat Polyclonal Anti-Rab11 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mousse, Canine, Monkey |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptides derived from within residues 110 aa to the C-terminus of mouse Rab11a, Rab11b and Rab11c (Rab25) produced in E. coli. |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
TGFBI Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Mouse, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | TGFBI antibody was raised against synthetic peptide C-QLYTDRTEKLRPE from an internal region of human TGFBI (NP_000349.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum (100%); Marmoset, Platypus (92%). |
TRPV2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Horse, Human, Monkey, Pig |
| Conjugation | Unconjugated |
| Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%). |
FBL Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FBL |
Rabbit Polyclonal Anti-SRD5A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
Rabbit Polyclonal Anti-HSD17B11 Antibody
| Applications | IHC |
| Reactivities | Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSD17B11 antibody: synthetic peptide directed towards the N terminal of human HSD17B11. Synthetic peptide located within the following region: TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG |
Serotonin transporter (SLC6A4) (579-599) rabbit polyclonal antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide sequence corresponding to amino acids (602–622) of rat 5HT transporter coupled to keyhole limpet hemocyanin (KLH). |
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Rabbit Polyclonal Antibody against LINGO1 (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LINGO1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-92 amino acids from the N-terminal region of human LINGO1. |
Active filters
Filter by
Target Symbol
- MAP2K1 (135)
- TP53 (54)
- MAP2K3 (50)
- CTNNB1 (41)
- EPN2 (35)
- UBE2G2 (35)
- AKT1 (34)
- IGF2BP2 (31)
- ACAA2 (30)
- PARVA (30)
- HSPD1 (28)
- DNAJA2 (25)
- NONO (25)
- PRKCE (25)
- SNX9 (25)
- VBP1 (25)
- ATP5F1B (21)
- HSPA1A (21)
- BCAR1 (20)
- DDX39B (20)
- DSTN (20)
- EPHX1 (20)
- HDAC6 (20)
- MAPK1 (20)
- NRBP1 (20)
- PIK3R5 (20)
- SERPINA1 (20)
- SSB (20)
- TRIM38 (20)
- EIF2S1 (16)
- ACAT2 (15)
- AK4 (15)
- BECN1 (15)
- FBXO21 (15)
- FERMT2 (15)
- FMR1 (15)
- GOLM1 (15)
- GTF3C4 (15)
- HRAS (15)
- ILVBL (15)
- MAPK9 (15)
- MSI1 (15)
- NLN (15)
- NXNL2 (15)
- PFKP (15)
- PPP5C (15)
- PSMA4 (15)
- PSMB9 (15)
- RAB21 (15)
- RNF113B (15)
- RPA2 (15)
- SAMHD1 (15)
- SENP2 (15)
- SERBP1 (15)
- SIGLEC9 (15)
- SQSTM1 (15)
- USP5 (15)
- XPNPEP3 (15)
- BUB1B (13)
- KRT18 (13)
- KRT8 (13)
- PSMA6 (13)
- CD4 (12)
- ACBD3 (10)
- ACY3 (10)
- APEX1 (10)
- BIN3 (10)
- CAT (10)
- CBWD1 (10)
- CHEK2 (10)
- CLPP (10)
- COMMD1 (10)
- CTH (10)
- DDT (10)
- DEF6 (10)
- DNM1L (10)
- DPP9 (10)
- FGG (10)
- GPI (10)
- IDH1 (10)
- KLK8 (10)
- LIMK1 (10)
- LMAN1 (10)
- LZIC (10)
- MTIF3 (10)
- NDUFB10 (10)
- NHEJ1 (10)
- NPTN (10)
- NQO2 (10)
- NT5DC1 (10)
- PDIA4 (10)
- PFN1 (10)
- PIK3CG (10)
- PMEL (10)
- PSMA2 (10)
- PSMB7 (10)
- PUDP (10)
- RPN1 (10)
- RUVBL2 (10)
- SCFD1 (10)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (5)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (3)
- Phospho-specific (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This is a chimeric mouse antibody, based on the original rat IgG2b format, created for improved compatibility with existing reagents, assays and techniques. (1)
Assay Types
Families
- Druggable Genome (2109)
- Transmembrane (514)
- Protein Kinase (408)
- Transcription Factors (381)
- Protease (238)
- Stem cell - Pluripotency (223)
- ES Cell Differentiation/IPS (218)
- Secreted Protein (116)
- GPCR (109)
- Adult stem cells (22)
- Cancer stem cells (16)
- Stem cell relevant signaling - DSL/Notch pathway (15)
- Induced pluripotent stem cells (14)
- Stem cell relevant signaling - JAK/STAT signaling pathway (13)
- P450 (12)
- Ion Channels: Potassium (11)
- Nuclear Hormone Receptor (11)
- Ion Channels: Transient receptor potential (9)
- Phosphatase (6)
- Ion Channels: Other (4)
- Stem cell relevant signaling - Wnt Signaling pathway (4)
- Embryonic stem cells (3)
- Ion Channels: ATP Receptors (3)
- Ion Channels: Calcium (1)
- Ion Channels: Sodium (1)
Pathways
- Pathways in cancer (425)
- MAPK signaling pathway (399)
- Focal adhesion (377)
- Prostate cancer (355)
- Colorectal cancer (350)
- Endometrial cancer (349)
- Metabolic pathways (349)
- Fc epsilon RI signaling pathway (344)
- Neurotrophin signaling pathway (334)
- Toll-like receptor signaling pathway (314)
- Chronic myeloid leukemia (313)
- Non-small cell lung cancer (309)
- Pancreatic cancer (308)
- Glioma (306)
- Melanoma (305)
- T cell receptor signaling pathway (296)
- Insulin signaling pathway (295)
- ErbB signaling pathway (294)
- Fc gamma R-mediated phagocytosis (279)
- Thyroid cancer (278)
- Chemokine signaling pathway (277)
- Acute myeloid leukemia (266)
- Progesterone-mediated oocyte maturation (265)
- Regulation of actin cytoskeleton (265)
- GnRH signaling pathway (264)
- Renal cell carcinoma (264)
- VEGF signaling pathway (260)
- B cell receptor signaling pathway (259)
- Bladder cancer (248)
- Melanogenesis (239)
- Natural killer cell mediated cytotoxicity (230)
- Gap junction (225)
- Vascular smooth muscle contraction (209)
- Prion diseases (193)
- Long-term depression (189)
- Long-term potentiation (189)
- Oocyte meiosis (167)
- Dorso-ventral axis formation (164)
- Wnt signaling pathway (146)
- Apoptosis (133)
- Amyotrophic lateral sclerosis (ALS) (122)
- Tight junction (119)
- Small cell lung cancer (118)
- Basal cell carcinoma (109)
- Endocytosis (108)
- Huntington's disease (106)
- mTOR signaling pathway (106)
- Leukocyte transendothelial migration (104)
- Type II diabetes mellitus (99)
- Parkinson's disease (90)
- Pathogenic Escherichia coli infection (89)
- Cell cycle (84)
- Adherens junction (81)
- Alzheimer's disease (81)
- Jak-STAT signaling pathway (77)
- Neuroactive ligand-receptor interaction (76)
- p53 signaling pathway (74)
- Proteasome (73)
- Fatty acid metabolism (60)
- Valine (60)
- leucine and isoleucine degradation (60)
- Ubiquitin mediated proteolysis (56)
- Adipocytokine signaling pathway (53)
- NOD-like receptor signaling pathway (52)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (51)
- Axon guidance (51)
- Purine metabolism (49)
- Glycolysis / Gluconeogenesis (45)
- Calcium signaling pathway (44)
- Cell adhesion molecules (CAMs) (44)
- Oxidative phosphorylation (43)
- Spliceosome (41)
- RNA degradation (39)
- Complement and coagulation cascades (38)
- Epithelial cell signaling in Helicobacter pylori infection (36)
- Hematopoietic cell lineage (36)
- Metabolism of xenobiotics by cytochrome P450 (36)
- Antigen processing and presentation (35)
- Fatty acid elongation in mitochondria (35)
- Type I diabetes mellitus (33)
- Nucleotide excision repair (32)
- Phosphatidylinositol signaling system (32)
- Pentose phosphate pathway (31)
- TGF-beta signaling pathway (31)
- Alanine (27)
- aspartate and glutamate metabolism (27)
- Amino sugar and nucleotide sugar metabolism (26)
- RIG-I-like receptor signaling pathway (26)
- Tryptophan metabolism (26)
- Butanoate metabolism (25)
- Galactose metabolism (25)
- Systemic lupus erythematosus (24)
- Arachidonic acid metabolism (23)
- DNA replication (23)
- Mismatch repair (23)
- Tyrosine metabolism (23)
- Cytokine-cytokine receptor interaction (22)
- Drug metabolism - cytochrome P450 (22)
- Pyruvate metabolism (22)
- Glutathione metabolism (21)
- Histidine metabolism (21)
- Homologous recombination (21)
- Lysosome (21)
- Pyrimidine metabolism (21)
- Renin-angiotensin system (21)
- Base excision repair (20)
- Lysine degradation (20)
- Primary immunodeficiency (20)
- Regulation of autophagy (20)
- Terpenoid backbone biosynthesis (20)
- Fructose and mannose metabolism (17)
- Hedgehog signaling pathway (17)
- Vibrio cholerae infection (17)
- Cysteine and methionine metabolism (16)
- Retinol metabolism (16)
- Propanoate metabolism (15)
- Selenoamino acid metabolism (15)
- Synthesis and degradation of ketone bodies (15)
- Starch and sucrose metabolism (14)
- Arginine and proline metabolism (13)
- Citrate cycle (TCA cycle) (11)
- Glycine (11)
- Inositol phosphate metabolism (11)
- N-Glycan biosynthesis (11)
- Nitrogen metabolism (11)
- Non-homologous end-joining (11)
- serine and threonine metabolism (11)
- Folate biosynthesis (10)
- Glycosaminoglycan degradation (10)
- Methane metabolism (10)
- beta-Alanine metabolism (10)
- Cardiac muscle contraction (9)
- Androgen and estrogen metabolism (8)
- One carbon pool by folate (8)
- Pantothenate and CoA biosynthesis (8)
- Caffeine metabolism (7)
- Drug metabolism - other enzymes (7)
- Maturity onset diabetes of the young (7)
- Phenylalanine metabolism (7)
- Sphingolipid metabolism (7)
- Basal transcription factors (6)
- Linoleic acid metabolism (6)
- Notch signaling pathway (6)
- Viral myocarditis (6)
- Aminoacyl-tRNA biosynthesis (5)
- Biosynthesis of unsaturated fatty acids (5)
- Cytosolic DNA-sensing pathway (5)
- Glycosphingolipid biosynthesis - ganglio series (5)
- Hypertrophic cardiomyopathy (HCM) (5)
- Other glycan degradation (5)
- RNA polymerase (5)
- SNARE interactions in vesicular transport (5)
- Steroid biosynthesis (5)
- Sulfur metabolism (5)
- Taurine and hypotaurine metabolism (5)
- Dilated cardiomyopathy (4)
- ECM-receptor interaction (4)
- Nicotinate and nicotinamide metabolism (4)
- Taste transduction (4)
- C21-Steroid hormone metabolism (3)
- PPAR signaling pathway (3)
- Riboflavin metabolism (3)
- Autoimmune thyroid disease (2)
- Olfactory transduction (2)
- Ribosome (2)
- ABC transporters (1)
- Allograft rejection (1)
- Asthma (1)
- D-Glutamine and D-glutamate metabolism (1)
- Ether lipid metabolism (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- O-Glycan biosynthesis (1)
- Phenylalanine (1)
- alpha-Linolenic acid metabolism (1)
- tyrosine and tryptophan biosynthesis (1)