Germany
Japan
United Kingdom
China
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Antibodies
View as table Download
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
USD 380.00
2 Weeks
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal PECAM-1 (Ab-713) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
Rabbit polyclonal ROR2 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ROR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 19-50 amino acids from the N-terminal region of human ROR2. |
Rabbit polyclonal Syndecan4 (Ab-179) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Syndecan4 around the phosphorylation site of serine 179 (E-G-SP-Y-D). |
Dopamine D2 Receptor / DRD2 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Chimpanzee, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | DRD2 / Dopamine Receptor D2 antibody was raised against synthetic 19 amino acid peptide from 3rd cytoplasmic domain of human DRD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Marmoset (100%); Gibbon, Monkey, Rabbit (95%); Dog, Bovine, Panda, Horse, Pig (89%); Mouse, Rat, Ferret, Bat, Hamster, Elephant (84%). |
Rabbit anti-LTBR Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LTBR |
Rabbit Polyclonal Anti-GABRA5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW |
Rabbit Polyclonal Anti-ACSL3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL3 antibody: synthetic peptide directed towards the N terminal of human ACSL3. Synthetic peptide located within the following region: LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI |
Rabbit Polyclonal CX3CR1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
Rabbit polyclonal VE-Cadherin (Tyr731) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human VE-Cadherin around the phosphorylation site of tyrosine 731 (H-I-YP-G-Y). |
| Modifications | Phospho-specific |
Calneuron-1 / CALN1 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Calneuron-1 / CALN1 antibody was raised against a 16 amino acid peptide near the amino terminus of human CaBP8. |
Rabbit polyclonal ACSL4 (FACL4) Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ACSL4 (FACL4) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-267 amino acids from the Central region of human ACSL4 (FACL4). |
Rabbit polyclonal IL1R Antibody (C-term E487)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL1R antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 474-503 amino acids from the C-terminal region of human IL1R. |
Rabbit polyclonal FOLR1 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FOLR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-68 amino acids from the N-terminal region of human FOLR1. |
Rabbit anti-GP9 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GP9 |
Rabbit anti-SIGMAR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SIGMAR1 |
Active filters
Reactivities
- Human
Applications
- IHC
Isotypes
- IgG
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Transmembrane
Citations
- Yes
Filter by
Category
Target Symbol
- BAX (3)
- ABCC4 (2)
- CCR6 (2)
- ABCC5 (1)
- ABCG2 (1)
- ACSL3 (1)
- ACSL4 (1)
- ADAM10 (1)
- ADCY1 (1)
- ANTXR1 (1)
- AQP4 (1)
- B3GLCT (1)
- BCL2L10 (1)
- CALCRL (1)
- CALN1 (1)
- CAV1 (1)
- CD274 (1)
- CD276 (1)
- CD46 (1)
- CD81 (1)
- CDH5 (1)
- CHRNA4 (1)
- CHSY1 (1)
- CLDN11 (1)
- CX3CR1 (1)
- CYP3A4 (1)
- CYP7A1 (1)
- CYP8B1 (1)
- DBH (1)
- DDR1 (1)
- DIABLO (1)
- DPAGT1 (1)
- DRD1 (1)
- DRD2 (1)
- EGFR (1)
- ELOVL3 (1)
- ELOVL5 (1)
- ERBB2 (1)
- FAIM2 (1)
- FFAR4 (1)
- FOLR1 (1)
- G6PC (1)
- GABRA5 (1)
- GCNT3 (1)
- GP9 (1)
- GPD2 (1)
- GPER1 (1)
- GPR183 (1)
- HAVCR1 (1)
- HLA-G (1)
- HMOX1 (1)
- IFNB1 (1)
- IGF1R (1)
- IL17RB (1)
- IL1R1 (1)
- ITGA2B (1)
- ITGA6 (1)
- ITGAX (1)
- ITGB6 (1)
- KDR (1)
- KLK5 (1)
- LAMP1 (1)
- LILRB2 (1)
- LTBR (1)
- MME (1)
- MTNR1A (1)
- NPHS1 (1)
- NPHS2 (1)
- PECAM1 (1)
- PROM1 (1)
- PTPRJ (1)
- RHBDD2 (1)
- ROR2 (1)
- S1PR3 (1)
- SCARA3 (1)
- SDC4 (1)
- SDF4 (1)
- SEMA3D (1)
- SIGMAR1 (1)
- SLC16A1 (1)
- SLC17A6 (1)
- SLC17A7 (1)
- SLC22A6 (1)
- SLC22A8 (1)
- SLC29A4 (1)
- SLC2A1 (1)
- SLC44A1 (1)
- SLC4A7 (1)
- SLC7A11 (1)
- SLC8A3 (1)
- SSTR3 (1)
- STIM1 (1)
- SV2A (1)
- SYT7 (1)
- THBD (1)
- TLR2 (1)
- TNFRSF8 (1)
- TRAM1 (1)
- TRPC6 (1)
- TRPV2 (1)
Antibody Hosts
Modifications
Pathways
- Metabolic pathways (11)
- Cytokine-cytokine receptor interaction (10)
- Pathways in cancer (9)
- Cell adhesion molecules (CAMs) (8)
- Focal adhesion (8)
- Neuroactive ligand-receptor interaction (7)
- ECM-receptor interaction (6)
- Calcium signaling pathway (5)
- Colorectal cancer (5)
- Hematopoietic cell lineage (5)
- Regulation of actin cytoskeleton (5)
- ABC transporters (4)
- Adherens junction (4)
- Adipocytokine signaling pathway (4)
- Apoptosis (4)
- Chemokine signaling pathway (4)
- Dilated cardiomyopathy (4)
- Endocytosis (4)
- Gap junction (4)
- Huntington's disease (4)
- PPAR signaling pathway (4)
- Alzheimer's disease (3)
- Amyotrophic lateral sclerosis (ALS) (3)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (3)
- Hypertrophic cardiomyopathy (HCM) (3)
- Leukocyte transendothelial migration (3)
- Neurotrophin signaling pathway (3)
- Prion diseases (3)
- Prostate cancer (3)
- p53 signaling pathway (3)
- Bladder cancer (2)
- Complement and coagulation cascades (2)
- Endometrial cancer (2)
- Epithelial cell signaling in Helicobacter pylori infection (2)
- ErbB signaling pathway (2)
- Fatty acid metabolism (2)
- Glioma (2)
- GnRH signaling pathway (2)
- MAPK signaling pathway (2)
- Melanoma (2)
- Natural killer cell mediated cytotoxicity (2)
- Non-small cell lung cancer (2)
- Oocyte meiosis (2)
- Pancreatic cancer (2)
- Primary bile acid biosynthesis (2)
- Progesterone-mediated oocyte maturation (2)
- Small cell lung cancer (2)
- Toll-like receptor signaling pathway (2)
- Vascular smooth muscle contraction (2)
- Viral myocarditis (2)
- Allograft rejection (1)
- Antigen processing and presentation (1)
- Autoimmune thyroid disease (1)
- Axon guidance (1)
- B cell receptor signaling pathway (1)
- Biosynthesis of unsaturated fatty acids (1)
- Cardiac muscle contraction (1)
- Chondroitin sulfate biosynthesis (1)
- Cytosolic DNA-sensing pathway (1)
- Dorso-ventral axis formation (1)
- Drug metabolism - cytochrome P450 (1)
- Drug metabolism - other enzymes (1)
- Galactose metabolism (1)
- Glycerophospholipid metabolism (1)
- Glycolysis / Gluconeogenesis (1)
- Graft-versus-host disease (1)
- Insulin signaling pathway (1)
- Jak-STAT signaling pathway (1)
- Linoleic acid metabolism (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Lysosome (1)
- Melanogenesis (1)
- Metabolism of xenobiotics by cytochrome P450 (1)
- N-Glycan biosynthesis (1)
- O-Glycan biosynthesis (1)
- Oxidative phosphorylation (1)
- Parkinson's disease (1)
- Porphyrin and chlorophyll metabolism (1)
- Purine metabolism (1)
- RIG-I-like receptor signaling pathway (1)
- Renal cell carcinoma (1)
- Renin-angiotensin system (1)
- Retinol metabolism (1)
- Starch and sucrose metabolism (1)
- Tight junction (1)
- Type I diabetes mellitus (1)
- Tyrosine metabolism (1)
- VEGF signaling pathway (1)